The New Paper, 18 April 2010

Lock icon This issue may only be viewed from the multimedia stations at NLB Libraries. See FAQ for more information.

Microfilm: NL30645
Total Pages: 72
1 32 The New Paper
Page thumbnail Page 1
  • Title Section
    Lock icon Masthead
    13 1 The New Paper on sunday April 18 2010 80 CENTS MICA (P) 118/01/2010
    13 words
  • Page 1 Advertisements
    • Advertisement
      Lock icon Page 1 Advertisements Column 1
      53 1 MAN CITY 0 MAN U 1 Feeling peckish? Last gasp goal and it’s oh, so... Sweet! 51 It’s food, glorious grub in our 32-page Breakfast Special PICTURE: ACTION The New Paper on April 18 2010 Changi residents outraged by bold transvestites filthy litter Stop havingsex at my doorstep2 80 CENTS
      53 words
Page thumbnail Page 2/3
  • News
    • Article, Illustration
      Lock icon 'It's an orgy at our doorstep'
      621 2/3  -  Changi Village transvestitestaketheir businesstonearby residential areas, having sex outside homes and leaving usedcondomsbehind. One resident says: REPORTS: GAN LING KAI ZAIHAN MOHAMED YUSOF tnp@sph.com.sg FORmorethanadecade,ChangiVillagehasbeenahauntfortransvestitesofferingsex.Now,theyhavegoneastepfurther–toresidents’ doorsteps. And residents nearby are sick of it. Sick of the shenanigansandthelitterinfrontoftheirhomes. Theyaregrossedoutbypilesofusedcondomsand soiledtissuepaper. The residents’ message to amorous
      TNP PICTURES: ZAIHAN MOHD YUSOF  -  621 words
    • Article
      Lock icon Couple makes out near teens having barbecue
      435 2/3 SOME teenagers are enjoying a barbecue at Changi Village. They laugh, play games and cook chicken wings on skewers at a chalet on Netheravon Road. Theydon’t seem tonotice asedan pullingup ata carpark just 30m away. With engine still running, two people, one in
      435 words
    • Article, Illustration
      Lock icon Plumes of gloom
      813 4  -  Man who flew MAS put up in hotel (above) while girlfriend, who flew SI A, stranded at Changi REPORT: CHONG SHIN YEN chongsy@sph.com.sg THEIR flights were delayed because of dark, distant, clouds of volcanic ash blown over Europe from Iceland. After that, Mr Joseph Ang, 26, and
      PICTURE: AP  -  813 words
    • Article, Illustration
      Lock icon Most popular costume is...
      655 8  -  Waitresses play dress-upinthis karaokebar REPORT: VEENA BHARWANI veenab@sph.com.sg SHEstrutsuptoyouwithajugofbeerinonehandandahandcuffintheother.She sets the jug down in front of you, flashes a big naughty smile and then cuffs you. The sexy cop, whose tight uniform barely covers her thighs, then whisks out her baton andspanksyouwithit. Thestuffoffantasies? No, just a
      TNP PICTURES: GAVIN FOO  -  655 words
    • Article, Illustration
      Lock icon Should TV chefs be the new rock stars?
      717 10 / 11  -  Celebrity TV chefs who endorse watchesandwalk the red carpet say they’renot distractedfrom their cooking REPORT: HEDY KHOO hedykhoo@sph.com.sg HISisafacethatgarnersTVratingsandadvertis-ingdollars.With his smouldering Latino looks, megawatt smile and easy charm, it is no wonder that he has become a household name in Madrid and
      TNP PICTURES: GARY GOH; PICTURES: FAIRMONT SINGAPORE, CITRUS PR  -  717 words
    • Article, Illustration
      Lock icon Hed chef meets hot chef
      346 10 / 11  -  REPORT: WOO SIAN BOON sbwoo@sph.com.sg WOULD you pay $68 to watch a chef at work? About 60 people who turned up for MasterchefDario Barrio’s masterclasson Thursday did. Andtheythoroughly enjoyed the11/2 session with Chef Barrio and his two chef helpers, who are in Singapore for the
      346 words
    • Article, Illustration
      Lock icon SHE’S THEIR MOTHER, SIBLING, GUARDIAN
      769 12 / 13  -  4 siblings are intellectually disabled and... REPORT: GAN LING KAI ganlk@sph.com.sg TAKING care of one person with intellectual disability is tough enough. Multiply that by four and you’ll have an idea of what Miss Eileen Seng goes through on a daily basis. That is because
      TNP PICTURE: GARY GOH  -  769 words
    • Article, Illustration
      Lock icon As dedicated as the able-bodied
      353 12 / 13  -  REPORT: TAY SHI'AN shian@sph.com.sg WHEN baking apprentice Siti Nur Ain Salleh, 20, earned her first pay cheque of $450 a month, she gave part of it to her family and bought herself a pair of red spectacles for $79. The money was special to the
      TNP PICTURE: LUKE YAN  -  353 words
    • Article
      Lock icon POLICIES FOR CAREGIVERS, WARDS
      218 12 / 13 Special Needs Savings Scheme (SNSS) Announced by MCYS last month, in collaboration with the Ministry of Manpower and the Central Provident Fund Board A parent can nominate his child with special needs to receive monthly disbursements from his CPF savings after his death Existing CPF interest
      218 words
    • Article, Illustration
      Lock icon PREGNANT POSE
      637 14 MoreJapanese women celebrating their bodies by posing nude IN JAPAN, despite ubiquitous sexual images on subway male magazine ads and billboards, the public still demands women stay traditionally prudish about nudity. But in a new trend, many Japanese women have become more at ease with taking off their
      PICTURES: AFP  -  637 words
    • Article, Illustration
      Lock icon UK woman banned from drinking alcohol for two years
      308 14 THEparty’sover for her. Miss Laura Hall (above), 20, has been from buying or drinking alcohol anywhere in England and Wales. Miss Hall is said to be the first person to have been slapped with the ban. The ban lasts for two
      PICTURE: INTERNET  -  308 words
    • Article, Illustration
      Lock icon Nude performers say they were groped
      346 15 MUSEUM patrons know that touching the art isano-no and thatmeans live, naked performers too. Several nude models who are featured in MarinaAbramovic’snew exhibitionatthe Museum of Modern Art (MoMA) in New York have complained of being groped by some patrons. The museum has declined to
      PICTURE: AP  -  346 words
    • Article, Illustration
      Lock icon Young tycoon charged with money laundering
      359 15 IN THE US HEHELPEDgamblersandillegalInter-net gambling companies launder US$500million($687million). TheUSprosecutorshavenowarrestedan AustralianmaninLasVegason moneylaunderingcharges. In a case unsealed in New York, prosecutors accused Daniel Tzvetkoff, 27, of processing gambling proceeds and making them appear legal to banks, starting in early2008. He created dozens of so-called shell companies
      359 words
    • Article, Illustration
      Lock icon He wanted to watch 9/11 attacks on TV but...
      603 16 Osama(right)couldn’t setupsatelliteTVlink, writesex-bodyguard OSAMA Bin Laden tried but failed to set up a satellite TV link at his Afghan hideout to watch the 9/11 attacks as they happened, according to his former bodyguard. Nasser al-Bahri, 37, who now preaches against the
      PICTURES: AFP, AP, REUTERS  -  603 words
    • Article
      Lock icon He steals $667,000 from disabled niece's charity fund
      233 16 HUNDREDS of thousands of pounds given by the UK public was put in a trust for Ellie May Challis, five, after she lost her limbs to meningitis. Her uncle, Darren Pease, 33, was a banker and trustee of the fund, but proved
      233 words
  • Page 2/3 Advertisements
Page thumbnail Page 4
Page thumbnail Page 5
  • Page 5 Advertisements
    • Advertisement
      Lock icon Page 5 Advertisements Column 1
      518 5 Go wild on your BlackBerry Smartphone from just $32.48/mth. Sk W' Get a BlackBerry® Smartphone for less just for students with NEW bundled and NSFs voice and data plans. Outgoing local talktime BlackBerry® Premium BlackBerry® Premium PowerValue 100 Student Plan PowerValue 300 Student Plan $32.48/mth $50.46/mth lOOmins 300mins FREE SMS/MMS
      518 words
Page thumbnail Page 6/7
  • News Plumes of gloom
    • Article, Illustration
      Lock icon When will it be OVER?
      638 6/7 IT’SBEENthreedayssincesouthernIceland’sEyjaf-jallajokull (pronounced EY-ya-fyat-lah-YOH-kuht) volcano began erupting for the second time in a month. Airports across Europe have been shut down and millionsofpassengershavebeenstranded. Thequestionis:Howlongwillthissituationcontinue?Whenwilltheworldseethelastof thevolcanicash spewingfromthecrater? Experts’opinionvary. AleadingScottishvulcanologisthaswarnedthatthe eruptionscouldlastforuptoayear. And, even more ominously, the eruptions of the comparatively small volcano have historically been linked tomassive eruptions
      TNP PICTURE: GAVIN FOO; PICTURE: COURTESY OF MR JOSEPH ANG  -  638 words
    • Article, Illustration
      Lock icon How will ashes SCATTER?
      540 6/7 WITH visibility reduced to a few hundred metres in parts of Europe, people are wondering how the ash will scatter. What direction will it take? Winds blowing the massive volcanic ash cloud from Iceland to continental Europe will continue in the same direction for at least
      ADAPTED FROM BBC  -  540 words
    • Article
      Lock icon Travel gloom, hotel boom
      302 6/7  -  Chong Shin Yen WHILE dark volcanic clouds could spell doom for airlines and gloom for travellers, there are some sectors which are reaping unexpected benefits. Hotels here have benefited from the travel disruption, with many reporting full occupancy. The Fullerton Hotel, a five-star luxury hotel, had
      302 words
Page thumbnail Page 8
Page thumbnail Page 9
  • Page 9 Advertisements
    • Advertisement
      Lock icon Page 9 Advertisements Column 1
      804 9 AIGNER SUBTLE SOPHISTICATION Exotica, luxury, sensuality and fantasy the themes to Udo Elding's new creations for Spring/ Summer 2010. Udo transforms this collection with unusual combinations that embody energy and fantasy. Ostrich, python and saurian leather awaken a longing for foreign lands and the portfolio combines a romantic flair for
      804 words
Page thumbnail Page 10 / 11
Page thumbnail Page 12 / 13
  • Page 12 / 13 Advertisements
    • Advertisement
      Lock icon Page 12 / 13 Advertisements Column 1
      82 12 / 13 forfeid'M" 1 Fly direct from Changi Terminal 1 YOGYAkARTA Dailly SGD 59 Booking Period: 12 April 25 April 2010 Travel Period: 10 May 25 August 2010 Book now at airasia.com or our Sales Office at Peninsula Plaza Get your rooms activites airasiago.com Seats are limited and may not be available
      82 words
    • Advertisement
      Lock icon Page 12 / 13 Advertisements Column 2
      38 12 / 13 Subscribe NOW to catch the latest and the best in World Cup action. All the thrills, the tips and the treats at just $100 (U.P $120.55) for 6 months. PLUS a chance to win $20,000 worth of prizes.
      38 words
Page thumbnail Page 14
Page thumbnail Page 15
  • Page 15 Miscellaneous
    • Miscellaneous
      Lock icon Page 15 Miscellaneous Column 1
      37 15 THE LATEST THRILLER FROM MARTIN SCORSESE Ong Sor Fern, SPH The Straits Times, Life! Whang Yee Ling, 8 DAYS, MediaCorp Pte Ltd PHOENIX%\ LEONARDO DiCAPRIO SOME PLACES GO Shutterlsland.com NOW SHOWING J Some violence 1 and nudity
      37 words
Page thumbnail Page 16
Page thumbnail Page 17
Page thumbnail Page 18
  • News Exchange
    • Article, Illustration
      Lock icon Punish the guilty and move on
      475 18  -  THE BUZZ COMMENT: S MURALI muralis@sph.com.sg I SUSPECT that there are many mountains in Singapore, and very few molehills. Do you feel the same way? I mean, some rowdy kids start a brawl after a rugby game and we seemingly go into The-Nation-Is-In-Cri-sis mode.
      475 words
    • Article, Illustration
      Lock icon SINGAPORE HAPPINESS INDEX
      121 18 Weratethepastweek’snews–goodandbad +10 The Singapore economy grew 13.1 per cent in the first quarter and the forecast for the whole year was raised to 7-9 percent. Non-oil domestic exports surged last month. +10 The Straits Times Index closed above 3,000 for the first time in almost two years.
      121 words
    • Article
      Lock icon OVERHEARD IN THE STREETS
      27 18 “Roller-breading.” –afour-year-oldboyexplainingto hismotherwhyhe’srunninghistoy train back and forth over a slice of bread. “Yourdogreally lookslikeyou.” –a“compliment”byawomanonthe resemblance between her friend and his new puppy.
      27 words
  • Page 18 Miscellaneous
Page thumbnail Page 19
  • enjoy
    • Article, Illustration
      Lock icon POLE POSITION
      660 19  -  First National Day Parade, then the Olympics?Poledancingfansaretrying topolevaulttheirpassioninto respectability and Olympic glory REPORT: JULIANA JUNE RASUL julrasul@sph.com.sg HEELS.Bikinitops.Sexymusic.These pole dancers may make yougo“wow”,butperhapsnotfor thereasonsyouthink. Theyspin,defygravityandwrapthem-selvesaround2.5m-highpoles. Most have no gymnastics background. Someareafraidofheights. dayatthePoleStarsTalentShowcaseSingapore 2010 for a chance to be the first Singaporean competitor at the International Pole Dance Fitness
      TNP PICTURE: GAVIN FOO  -  660 words
    • Article, Illustration
      Lock icon In a dilemma over gender
      432 20 STARES from the audience may be the norm for pole dancers. Buttransgenderperformer Marla Bendini (right), 23, has to deal with even more scrutiny than others. The student of Nanyang TechnologicalUniversity’sSchoolof Art, Design and Media, whose real name is Bendini Junior Ong, has been told by
      TNP PICTURES: GAVIN FOO  -  432 words
    • Article, Illustration
      Lock icon Punky kimono bags the win
      387 21  -  Code Jeanius final at Bugis Junction REPORT:YAW YAW MIN JIE yminjie@sph.com.sg ITWASthirdtimeluckyforJoelXiang,21.Athisthirdattempt,theLaSalleSchoolofthe Arts fashion design student finally wonintheCodeJeaniuscompetition,heldat BugisJunction. Thejudgesforthecompetitionwerefashion designer Frederick Lee, Lee Cooper sales manager Ainslie Chan and The New Paper columnistYeohWeeTeck. Mr Xiang’s bold and original design pleasedMrLee. MrLee said: “I was
      TNP PICTURES: CHOO CHWEE HUA  -  387 words
    • Article, Illustration
      Lock icon THE GAME NEVER ENDS AT THE TIGER FOOTBALL STADIUM? ‘SIMPLY GRRREAT’
      476 22 / 23  -  Morethan1,000luckyNew Paperreadersdescend inredandbluetowatch Manchester City v ManchesterUnitedatthe Tiger Football Stadium REPORT: NG YANG HAN ngyh@sph.com.sg A GIANT tent at Merchant Loop was turned into the city of Manchester last night. About 1,000 fans decked out in red and blue
      TNP PICTURES: CHOO CHWEE HUA  -  476 words
    • Enjoy Fly on the Wall
      • Article, Illustration
        Lock icon BRAND ROYALTY
        486 24 / 25  -  GucciParagonStore relaunchattendedbyJohor Sultan’ssonanddaughter SYLVIA TOH PAIK CHOO paikchoo@sph.com.sg HE FLIES helicopters and he showed up at the event in a Hummer. No, not his governorship Arnie Schwarzenegger, but young Mr Idris Ibrahim, 22. “I parked it down some hotel,” the personable lad said of his coveted set of
        TNP PICTURES: GARY GOH  -  486 words
      • Article, Illustration
        Lock icon Stylish trio inducted into Tatler's Fashion Hall of Fame
        355 24 / 25  -  REPORT: SYLVIA TOH PAIK CHOO paikchoo@sph.com.sg FASTEST fingers on the speed dial won the day– dress rather– for fashionforwarders Dr Iroshini Chua and homemaker Ms Susanna Kang. The pair, together with fundraiser Mrs Nana Au-Chua, were inducted into society monthlySingaporeTatler’sFashion Hall
        PICTURES: SINGAPORE TATLER  -  355 words
    • Enjoy Shopping
      • Article, Illustration
        Lock icon Investments in statements
        475 26  -  aspire It’sthelittlethings that count in turning a look into a stunner ANGELINE NEO tnp@sph.com.sg LAST year’s financial slump taught us that you can survive with a lot less than you think. To be sensitive to the economy last year, many designers shrank their collections. In throwing out
        PICTURES: FENDI, VALENTINO, BOTTEGA VENETA  -  475 words
    • Enjoy Hed Chef
      • Article, Illustration
        Lock icon Time to spice things up a little
        171 27  -  HEDY KHOO hedykhoo@sph.com.sg GIRLS love bad boys the way we love high heels. Both can let you down at a critical moment, leaving you in pain, or worse, with a broken heart. But who wouldn’t throw caution to the wind when caught up
        171 words
      • Article, Illustration
        Lock icon SPICY FRIED POMFRET
        209 27 INGREDIENTS 1 black pomfret (500g) 10g ginger 2 shallots 1 clove garlic Juice of one large lime 1 tbsp chickpea flour, also known as besan flour SPICE BLEND 1/4 tspground clove 1/2 tsppomegranate seed powder 2 tsps ground turmeric 1/2 tspcorianderpowder 1/2 tspground cumin 1/4 tspground fennel
        TNP PICTURES: KUA CHEE SIONG, HEDY KHOO  -  209 words
    • Enjoy Humour
      • Article, Illustration
        Lock icon Read this and take the roof over my head
        571 28  -  Write up your will and clear yourmental space SYLVIA TOH PAIK CHOO JUST PAIK CHOO paikchoo@sph.com.sg A TOUR guide who shepherded us into numbered trolleys at some California amusement park raised his voice: “Who can tell me the importanceof the number2?”
        ST FILE PICTURE  -  571 words
      • Article
        Lock icon REALLY? Last but not least
        151 28 Oddnews that’sfor real A BRITISH man went on a day trip to France, accidentally leaving his mother-in-law in her 70s waiting in a ferry car park in Dover. The man and his wife dropped their vehicle off in a long-stay car park in Dover, after
        151 words
      • Article
        Lock icon Hair stimulus package
        76 28 AP IT’Stime thatmustachioed Americans got in on the stimulus money. Atleastthat’s the proposal being pushed by tax policy professor John Yeutter and the St Louis-based American Mustache Institute (AMI). The tongue-in-cheek group dubs itself“the world’sonlyfacialhair advocacyandresearch organisation”. On the eve of the deadline to file income tax
        AP  -  76 words
      • Article, Illustration
        Lock icon 'Ice-cream sandwich': The PCK of S'pore food?
        415 28  -  S M ONG ACT BLUR smong@sph.com.sg A FEW years ago when I was putting together the series finale of Phua Chu Kang Pte Ltd, I wanted to include a clip of PCK’s appearance in the third season of The Amazing Race. Handing out
        415 words
    • Enjoy Column & TV
      • Article, Illustration
        Lock icon Obey the Xbox
        422 29  -  Parenting can be easy with ahumble,5-yearoldgameconsole S MURALI FATHER FIGURES muralis@sph.com.sg IKNOWtheAppleiPadisalltherageatthemoment.But in my house, I give thanks each day formyhumbleXbox. Yes,Iknowthatitcameoutfiveyearsago, but the Xbox 360 still gives me countless hours of joy as I play the latest Fifa soccer gameonit. And in the past few weeks,
        TNP FILE PICTURE  -  422 words
    • Article, Illustration
      Lock icon Enjoy Social
      83 33 Thisweek,we’reshowcasingphotosofhowyouenjoy your favourite hobbies. For two weeks from May 2, send us pictures of you and your pets. Send your pictures and messages to tnpforum@sph.com.sg Together we learn how to roller blade, not too young and not too old to learn. Yusri Thank You Daddy and Mummy for
      83 words
  • Page 19 Advertisements
Page thumbnail Page 20
Page thumbnail Page 21
Page thumbnail Page 22 / 23
  • Page 22 / 23 Advertisements
Page thumbnail Page 24 / 25
  • Page 24 / 25 Advertisements
    • Advertisement
      Lock icon Page 24 / 25 Advertisements Column 1
      61 24 / 25 5 v > I. *Enjqy Qhattjng In A. More Cakprful: website www.d MA FREELIINE: 61QQ 660*1 ■900 *****17 Callers must be 18 C above. 3G calls are charged at S1.S9/min. Exercise precautions when mooting with friends from this service. Meeting in large groups is strongly advised. Deny Access/ Complaints/ Helpline:
      61 words
Page thumbnail Page 26
  • Page 26 Advertisements
    • Advertisement
      Lock icon Page 26 Advertisements Column 1
      98 26 T> K r < i The Most Happening Chat Club CHAT PARTY 1900-9123-321 50 cents/min LADIES FREE LINE: ***** 800 Top 3 Ladies Win Total Cash Prize of 2000. Chatty And WittylRmends ForeverfFri'e umine paymenx avanaoie w www.Tasiiaiiv.com.sg 'Terms Conditions apply. All decisions made by JP Solutions Pte. Ltd. shall
      98 words
Page thumbnail Page 27
  • Page 27 Advertisements
    • Advertisement
      Lock icon Page 27 Advertisements Column 1
      62 27 24hr Hot, Fun Zone WIN DAILY $50CASH! Ladies: Chat with NO Limit! (j3uys: Enjoy 10 Free Lines^) S PARTYchat 1900-912-960 J H NO MORE 1900: Enjoy First 10min @ONLY $1.99. Pay by Debit/Credit card. Call 6767-6969 Now! Callers must be 18 years old above. Be cautious when meeting strangers from
      62 words
Page thumbnail Page 28
Page thumbnail Page 29
  • Page 29 Miscellaneous
    • Miscellaneous
      Lock icon Page 29 Miscellaneous Column 1
      280 29 WATCH’EM PICTURE: FESTIVE FILMS The Brothers Bloom (above) Star Movies (StarHub Ch 58), 9pm Two millionaire-swindling con men decide to take onone lastjob showinga beautifuland eccentric heiress the time of her life with a romantic adventure that takes them around the world. Starring Adrien Brody, Rachel Weisz. The Year Of
      280 words
Page thumbnail Page 30/31
  • Page 30/31 Advertisements
    • Advertisement
      Lock icon Page 30/31 Advertisements Column 1
      12 30/31 Organiser: Official Paper: /iDHin Si Official Radio: Official Venue: SCAPE www.scape.com.sg r
      12 words
    • Advertisement
      Lock icon Page 30/31 Advertisements Column 2
      52 30/31 Takeheart, takepart Nota fanof dancing?There are otherwaystojoin thefun. F&NGuess-the-Winnercontest HostedonStomp.Pick the team thatyou thinkwillwin the competitionand youstand towin a prize. F&NTasteItShare It promo Fromnext monthtill theend of May,buy anF&N sparklingdrink productand youwill qualifyfora luckydraw. Youstand a chanceto winanHTC phonedailyorthe grandprize ofa 3D2N tripto Osakato watchDance DelightVol 17with threeothers. Visitwww.fnn.com.sgand www.facebook.com/FnNFunfor
      52 words
  • Article, Illustration
    Lock icon Dancers set to blaze the DANCEFLOOR
    288 30/31 The finals for the Singapore Dance DelightVol1arefinallyhere presents pnncE PELICHT I I :s Thosewhohave boughtyour tickets, don’t forgetto attendtheeventat*Scape– The Warehouse at 7.30pm. Ticketsare allsoldout. But,ifyouwant tojoin inthe fun,danceyour way downto outsideNgeeAnn City. From2pm, be a partof the funflashmobwhere the F&NLala Dancewill be performed.
    288 words
Page thumbnail Page 32
  • Page 32 Miscellaneous
    • Miscellaneous
      Lock icon Page 32 Miscellaneous Column 1
      117 32 SEEING STARS BYKUAH SENG SENG Singapore’smostaccuraetfakeastrologer ARIES: When life gives you lemons, make lemonade. But what life throws at you this week will make a juice that smells faintly of papaya, otter and that homeless guy you met on the bus. TAURUS: You will help an obscure band get its
      117 words
Page thumbnail Page 33
Page thumbnail Page 34
  • Sports
    • Sports Racing
      • Article
        Lock icon Join the Bank’s Gift queue
        1986 34  -  LARRY FOLEY’S COMMENTS FORTODAY’S KRANJI RACES RACE 1 (1,100m) 1 Blitz???Excuses not to win in his last start and will go very close to making amends in this. 2 Racing Classic??Would have appreciated first-up run; expect solid showing. 3 Westside Club??Should be in this for
        1,986 words
      • Article, Illustration
        Lock icon Sunday’s Tips
        450 34 Tan Thean Loon Danny Khoo Marc Tan Larry Foley RACE 12 RACE 11 RACE 10 RACE 9 RACE 8 RACE 7 RACE 6 RACE 5 RACE 4 RACE 3 RACE 2 RACE 1 As Good As It Gets Lion City Tycoon Street Ruffian High Centennial 9 Daring Junior
        450 words
      • Article
        Lock icon TODAY'S SINGAPORE (LONG COURSE C/POLYTRACK) RACE CARD
        1430 35 BEST BET BETTERTHANEVER(Race10No.1) RACE1 MS 12.45 -1100m(Polytrack) Stakes:$35,000 No. Last6runs HORSE Wt Rating Jockey Barrier (Age/origin/sex,trainer-owner) 1 *****2 Blitz 59 (51) TRBarnabas*c3 9 (5agMClements-OHM'S) 2 76-206 RacingClassic 57 (47) KBSoo 1 (4agJMeagher-Lim's) 3 ***** WestsideClub 56.5 (46) DBeasley 7 (3agMFreedman-Horizon) 4 -080 ReddySpeed
        1,430 words
      • Article
        Lock icon TODAY'S IPOH RACE CARD
        1310 36 GOING FORECAST: GOOD TO YIELDING TANTHEANLOON’SIPOHTIPS RACE 1:20 Sunshine Beauty 17 Freedom 10 Big Beau RACE 2:2 Will Power 8 Satisfaction 10 Lady Killer RACE 3:13 Victoire Pisa 12 Eishin Apollon 2 Hansode Bando RACE 4:9 Palmston 13 Sir Ed 4 Classic Sparkle RACE 5:6 Slipa
        1,310 words
      • Article, Illustration
        Lock icon YESTERDAY'S IPOH RESULTS
        614 37 GOING: YIELDING SAIFUDIN ISMAIL: Completed a hat-trick at Ipoh yesterday with Four Aces in Race 5, newcomer Bintang Terang in Race 6 and Arowana Bullet in Race 8. Race1 OB38(LC)1200m 4 CHINAGREAT56.5(185-39) OChavez (1) 1 1 1 (497) 2 PRIORKING57(107-24) NCallow (7) 2 2 2 (480) 0.5
        614 words
      • Article
        Lock icon YESTERDAY'S AUSTRALIA (RANDWICK/ASCOT/TOOWOOMBA) RESULTS
        819 37 RACE 1 (Randwick) 1st 8 Herculian Prince ($11-$11) 2nd 3 Above Average ($5) 3rd 6 Booming ($18) 4th 10 Sainthood. Forecast $8. Place forecast $21 (3-6), $7 (3-8), $13 (6-8). Tierce $88. Trio $36. Quartet No winner ($594 jackpot carried forward to next race). Scratching: Jimmy
        819 words
    • Sports Mad about Golf
      • Article, Illustration
        Lock icon Yana tames the winds in Suzhou
        427 38 AFP YANG Yong Eun, Asia’s first Major winner, shot a bogey-free four-un-der 68 yesterday to hold a one-stroke lead going into the final round of the US$2.5 million ($3.8m) Volvo China Open in Suzhou. The PGA Championship winner is 14-under-par at a blustery Suzhou
        AFP; PICTURE: GETTY IMAGES  -  427 words
      • Article
        Lock icon It's Murakami, thanks to birdie-birdie finish
        351 38 AFP FILIPINO Artemio Murakami won a dramatic last-gasp victory at the Mer-cedes-Benz Masters Philippines yesterday in Manila, making birdies on his final two holes to beat the chasing pack by a single stroke. Murakami closed with a final-round five-under 67 on his home course
        AFP  -  351 words
      • Article
        Lock icon Big prize for Anna
        137 38 AFP SWEDEN’S Anna Nordqvist won the inaugural Mojo 6 Jamaica LPGA Invitational yesterday, beating Amanda Blumenherst 1-up in the six-hole championship match at Montego Bay. Nordqvist, who won the LPGA Championship and season-end-ing LPGA Tour Championship last year, earned US$350,000 ($490,000) in the unofficial event at
        AFP  -  137 words
    • Sports Rugby
      • Article, Illustration
        Lock icon S'pore crash in injury time
        609 39  -  ASIAN FIVE NATIONS DIV1 FINAL SINGAPORE 16 SRI LANKA 23 Not our day GREGORY LOO npsports@sph.com.sg IT WENT all the way down to the wire. Not surprisingly, for as in many of the previous contests the games have been close (it was 20-20 in 2008
        TNP PICTURES: KUA CHEE SIONG  -  609 words
    • Article, Illustration
      Lock icon COMEBACK CHAMPIONS
      1092 40 This season, seven-time world champion Michael Schumacher makes his Formula One comeback after a three-year break. We take a look at other former champions who had found the temptation for further glory too good to resist LANCE ARMSTRONG (CYCLING) THE COMBATIVE seven-time Tour de France championcouldn’tresistanothertiltatthegreatest cycling race
      PICTURES: AFP, AP, ACTION IMAGES; AFP  -  1,092 words
    • Sports Formula One
      • Article, Illustration
        Lock icon VETTEL JUST WANTS TO WIN
        1288 42/43 GermanFormulaOne driver Sebastian Vettel revealstoRedBullhis wishtoemergechampion andhowhegoesabout workingtowardsthatgoal Sebastian, you achieved three poles and a win in the first three races. Did you expect such a strong start to the season? VETTEL: We were very strong last year. It was Red Bull’s and my best
        PICTURES COURTESY OF RED BULL; PICTURE: COURTESY OF ESPN STAR SPORTS  -  1,288 words
      • Article, Illustration
        Lock icon Shahrukh’s maiden visit
        310 42/43 StarSports’SANJEEVPALARinterviews Bollywood superstar SHAHRUKH KHAN, who made a surprise appearance at his very first F1 race at the recent Malaysian Grand Prix Shahrukh, is this your first visit to F1? SHAHRUKH: Yes, absolutely on any kind of track. I was just telling Karun that the last time
        310 words
      • Article, Illustration
        Lock icon Magical Vettel
        479 44  -  RedBull’sSebastianVettelstormedto histhirdpoleoftheseasonatthe ChineseGrandPrixinShanghai yesterday.Wepreviewtonight’srace LUKE NETTO npsports@sph.com.sg RED BULL Racing’s prodigy Sebastian Vettel is really in a class of his own. In the Chinese Grand Prix qualifying at Shanghai yesterday, he once again outclassed everyone on the grid by over two-hun-dredths of a second to secure his third
        PICTURE: GETTY IMAGES; Source from FIA  -  479 words
      • Article, Illustration
        Lock icon F1 2010 CHINESE GRAND PRIX
        12 44 ROUND 4 April 18 Shanghai International Circuit
        12 words
      • Article, Illustration
        Lock icon Schumi struggling?
        110 44  -  LUKE NETTO MERCEDES GP’s Michael Schumacher is probably the biggest talking point in Formula One at the moment. Everybody is just waiting for Schumi to return to his best and now many are starting to wonder if he still has it in him. There was a camera shot
        110 words
    • Sports EPL
      • Article, Illustration
        Lock icon Dixie the EPL fixture sage
        607 45  -  ALISON RATCLIFFE FOOTBALL FEMME npsports@sph.com.sg I SUPPOSE the computer that generates Premier League fixtures is a mere common or garden desktop with a natty piece of software installed. But in my mind it is like the giant grey metal computers of the 1960s, with wires
        TNP FILE PICTURE; PICTURE: REUTERS  -  607 words
      • Article, Illustration
        Lock icon Maicon’s wonder goal sends Inter top
        126 45 FORZA! AP MAICON scored a spectacular goal and Samuel Eto’o addeda secondin injury time togive Inter Milan a 2-0 win over 10-man Juventus yesterday morning (Singapore time) to provisionally reclaim theSerie A lead. Maicon (above) downed the ball on his knee and juggled it
        AP  -  126 words
      • Article, Illustration
        Lock icon WORLD CUP 2010 54 DAYS TO GO
        67 45 The 19 54 World Cup final on July 4 was referred to as “TheMiracleof Berne”. Underdogs Germany lifted their maiden World Cup crown by stunning the Mighty Magyars of Hungary 3-2.The gameatBerne’s Wankdorf Stadium inspired a 2003 German film of the same name.
        67 words
      • Article, Illustration
        Lock icon Tigers toothless at steady Blues
        508 49  -  Birmingham ................0 Hull ............................0 Kick-off 3pm (UK time) Birmingham: Hart, Carr, Johnson, Dann, Ridgewell, Gardner, Ferguson, Bowyer, Fahey (Larsson 63), Jerome, McFadden (Phillips 60). Subs not used: Taylor, Benitez, Michel, Parnaby, Vignal. Hull: Duke, McShane, Sonko, Mouyokolo, Dawson, Fagan,Bullard,Boateng,Cairney,Kilbane,Vennegoor of Hesselink (Altidore 75). Subs not
        PA Sport  -  508 words
      • Article, Illustration
        Lock icon Taylor double turns the tie Bolton’s way
        222 49  -  Stoke. .........................1 Bolton ........................2 Stoke: Kitson 13 Bolton: Taylor 85,88 Kick-off 3pm (UK time) BY DAVID COLE Special Correspondent BOLTON took a massive step towards survival thanks to MatthewTaylor’slatebraceat Stoke. Dave Kitson had given the Potters a first-half lead after latchingontoTuncaySanli’spass and rounding
        222 words
      • Article, Illustration
        Lock icon Fraizer floors Clarets
        374 50  -  Sunderland ..................2 Burnley ........................1 Sunderland: Campbell (25), Bent (40) Burnley: Thompson (82) Sunderland: Gordon, Hutton, Turner, Mensah (Ferdinand 46), Richardson, Campbell, Meyler (Zenden 88), Henderson, Malbranque, Jones, Bent (Mwaruwari 90). Subs not used: Carson, Bardsley, Da Silva, Kilgallon. Booked: Malbranque, Mensah, Meyler. Burnley: Jensen, Mears, Cort, Duff,
        374 words
      • Article, Illustration
        Lock icon Cahill fires Toffees’ bid for Europe
        251 50 PA Sport EVERTON boss David Moyes hailed his match-winner Tim Cahill, after the goalscoring midfielder netted late on in the 3-2 success at Blackburn. Moyessaid:“Ithasbeenhis trademark that he can get goals for us. “Hehastendedtogetus10 plusgoalsaseason.I’vehad some good players and Tim is certainlyupwiththebest.” Everton striker
        PA Sport  -  251 words
      • EPL ACTION WITH Tiger
        • Article, Illustration
          Lock icon EXTRA-SPECIAL SCHOLES United’s win well-earned
          748 51  -  The New Paper football analyst TOHARIPAIJAN shares with DA VID LEE how Man United earn their last-minute victory TOHARI PAIJAN THIS is yet another last-minute story written by Manchester United. And this time, Paul Scholes is the main character scoring the 93rd-minute winner in his
          TNP ILLUSTRATION: TEOH YI CHIE  -  748 words
        • Article, Illustration
          Lock icon You're a winner, Scholesy
          445 54 SIR ALEX Ferguson hailed Paul Scholes for keeping Manchester United's English Premier League title hopes alive. Scholes scored in the third minute of injury time to settle the Manchester Derby at Eastlands 1-0 in United's favour and keep the reigning champions in sight of leaders Chelsea.
          PICTURE: GETTY IMAGES  -  445 words
      • MATCH OF THE WEEK WITH Tiger
        • Article, Illustration
          Lock icon KISS of LIFE
          303 52/53  -  BreathinglifebackintoManchester United’stitlehopes,PaulScholes’ late winner showed that the Red Devils, as always, never give up MANCITY0 MAN UNITED 1 (Paul Scholes 90+3) GARY LIM npsports@sph.com.sg THECLOCKwasticking.With every movement of the secondhand,Manchester United’s Premiership title hopes were inching closer andcloserto anatural death. Yet, just when it looked all over
          PICTURE: GETTY IMAGES  -  303 words
        • Article
          Lock icon How important is Scholes to United?!
          171 52/53  -  GARY LIM PAUL SCHOLES might have lost much of his speed over the last few years. But at this stage of the season, it is the veterans like Scholes and Ryan Giggs who will be most important to a team fighting for the Premiership
          171 words
        • Article
          Lock icon Can Man City hang on to fourth place?
          204 52/53  -  GARY LIM NO MATTER what happens in yesterday’s late game between Tottenham Hotspur and Chelsea, Man City still have their fate in their own hands. As it is, it seems only Spurs have the ability to wrest the final Champions League spot
          204 words
        • Article
          Lock icon Did United deserve the win?
          200 52/53  -  GARY LIM IN ALL fairness, Man City have every reason to feel hard done by. They did enough to win the match. They defended well, created goal-scoring opportunities and showed adventure. Yet, in a close encounter such as this, one lapse of concentration is all
          200 words
        • Article, Illustration
          Lock icon TNP football analyst JOHN BURRIDGE says: Fergie has done it again
          437 52/53  -  INTHEKNOW JOHNBURRIDGEsays: John Burridge is a former Man City goalkeeper. WHEN I saw how Sir Alex Ferguson went out with a cautious 4-5-1, I was about to have a right go in my post-match criticisms for the United manager.
          437 words
    • Sports Football
      • Article, Illustration
        Lock icon Singapore fever hits Malang
        672 46/47  -  AremaIndonesia’sunlikelyrisetothetopofthe IndonesiaSuperLeaguetablehascapturedthe imaginationofitsfanaticalsupporters.Butit alsopropelledSingaporeansNohAlamShah andRidhuanMuhammadtorockstarstatus, waybeyondtheirwildestdreams GARY LIM npsports@sph.com.sg AT FIRST, there was uncertainty. Employed by an overseas club for the first time in their career, Singapore footballers Noh Alam Shah and Ridhuan Muhammad were hoping for the best, but prepared for the worst. Soon, they
        PICTURES: BH  -  672 words
      • Article, Illustration
        Lock icon The things fans do for love
        522 46/47  -  GARY LIM npsports@sph.com.sg MALANG may be more than 1,400km away from Singapore, but you can still see a Singapore flag at the Kanjuruhan Stadium in every Arema Indonesia home game. This gives you an idea of the affection the Arema fans feel for their
        TNP PICTURES: GARY LIM  -  522 words
    • Sports EPL Betting
      • Article, Illustration
        Lock icon Wigan a tough nut to crack
        567 48 Wire Services WIGANareinchingtheirwaytowardssafe-ty,thoughbossRober-to Martinez faces a nail-biting endto the season. Wednesday’s goalless draw with Portsmouth will be seen as two points dropped, as the Latics passed up the chance to all but seal their Premiership safetywith awin. Martinez’s team has a five-point cushion over
        Wire Services; PICTURE: GETTY IMAGES  -  567 words
      • Article
        Lock icon Villa need the goals to flow again
        444 48 Wire Services ASTON VILLA travel to Portsmouth today knowing that only a victory will keep their fading fourth place hopes alive. On the face of it, Villa would seem to have nothing to worry against cash-strapped and relegated Portsmouth, who off the pitch
        Wire Services  -  444 words
    • ONTV
      • Article, Illustration
        Lock icon FOOTBALL
        131 55 LIVE TELECASTS EPL Tonight: WIGANv ARSENAL StarHub TV Ch 27,8.25pm Arsene Wenger has insisted once again that Cesc Fabregas (right) is not for sale. PORTSMOUTH v ASTON VILLA StarHub TV Ch 27,10.55pm Tuesday: LIVERPOOL v WEST HAM StarHub TV Ch 27,2.55am Thursday: HULL v ASTON VILLA StarHub TV Ch
        PICTURE: ACTION IMAGES  -  131 words
      • Article
        Lock icon F1
        21 55 CHINESE GP Today: PREVIEW StarHub TV Ch 24,2pm MAIN RACE StarHub TV Ch 24,2.45pm CHEQUERED FLAG StarHub TV Ch 24,4.45pm
        21 words
      • Article
        Lock icon TENNIS
        11 55 MONTE CARLO ROLEX MASTERS Today: FINALS StarHub TV Ch 22,8.30pm
        11 words
      • Article
        Lock icon BADMINTON
        10 55 ASIAN BADMINTON CHAMPIONSHIPS Today: FINALS StarHub TV Ch 21,4pm
        10 words
      • Article
        Lock icon GOLF
        10 55 VERIZON HERITAGE Tomorrow: DAY 4 StarHub TV Ch 26,4.15am
        10 words
      • Article
        Lock icon WHAT'S ON
        511 55 EVENTS LOCAL EVENTS SHOOTING What: ISSF World Cup Rifle, Pistol and Shotgun When: Till April 25 Where: Beijing, China THE OPENING ceremony for the competition will take place today. The events for tomorrow are: 25m Pistol Women Precision Stage, Skeet Men Day 1, Skeet Women, 10m Air Rifle
        511 words
Page thumbnail Page 35
Page thumbnail Page 36
Page thumbnail Page 37
  • Page 37 Miscellaneous
    • Miscellaneous
      Lock icon Page 37 Miscellaneous Column 1
      30 37 Saturday,April17 2010 First Second Third 2420 8582 1247 Starters 8755 0316 4429 2324 2465 6279 3610 1340 1369 1068 Consolations 6516 2600 5589 2873 0749 8499 7313 4548 0551 5908
      30 words
Page thumbnail Page 38
  • Page 38 Advertisements
    • Advertisement
      Lock icon Page 38 Advertisements Column 1
      56 38 New Opening Zen Thai Spa at Marina Country Club (Ponggol) The Charm of old Ponggol.... The Lure of a Marina Your search for the perfect get-away ends here Full spa facilities All rooms with attached shower "Ample car park Thai Shiatsu Massage v 600 Ponggol Seventeenth Avenue 4 (off Ponggol
      56 words
  • Page 38 Miscellaneous
Page thumbnail Page 39
Page thumbnail Page 40
Page thumbnail Page 42/43
Page thumbnail Page 44
Page thumbnail Page 45
Page thumbnail Page 46/47
Page thumbnail Page 48
Page thumbnail Page 49
Page thumbnail Page 50
Page thumbnail Page 51
Page thumbnail Page 52/53
  • Page 52/53 Advertisements
    • Advertisement
      Lock icon Page 52/53 Advertisements Column 1
      893 52/53 Yet, just when it looked all over for the Red Devils, they hauled themselves right back into it. With practically the last move of the match, Paul Scholes directed a wonderful 93rd-minute header into the back of the net to help Man United to a 1-0 win over Man City
      893 words
Page thumbnail Page 54
Page thumbnail Page 55
  • Page 55 Advertisements
    • Advertisement
      Lock icon Page 55 Advertisements Column 1
      25 55 BLURB SUBSCRIBE TOTNP Here’syourchance toget TNP everyday.Call 6388-3838to subscribeor go to www.sphsubscription.com.sg NOON EDITION Lookout forthe latestreports onthe EPL matches inour NoonEdition on Wednesday andThursday.
      25 words
Page thumbnail Page 56
  • Page 56 Advertisements
    • Advertisement
      Lock icon Page 56 Advertisements Column 1
      59 56 WRITE THE FUTURE. > y. i m AtE 'V VAPOR SUPERFLYII f\ h* rj j dr a f i 6 I 1 UC r MASTER SPEED WITH NIKEFOOTBALI NIKEF00TBALL.C0M.SG THE ADAPTIVE STUDS ON THE MERCURIAL VAPOR SUPERFLY II EXTEND AND RETRACT FOR LETHAL GRIP IN CHANGING PITCH CONDITIONS. REWRITE THE
      59 words
Page thumbnail Page 1
  • Page 1 Advertisements
    • Advertisement
      Lock icon Page 1 Advertisements Column 1
      50 1 WHAT'S FOR •Top models I II ana celebrities reveal their breakfast faves m it /■J ffl -.2 I M n f f 1*1* L1»J IT7;/ < tvi;, .r*r£2* K 'fc' 1 i' m i* f fk > m 0^ g f >: CBS'S a. BSS5 JS3 ajji I Traditional is
      50 words
Page thumbnail Page 2
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      153 2 at %lL Mllll OM orddmc door dfMj in Sim lAWw^'w lis m S 'did. o«0) UiM$ |®g m iMf r Ai| o**>*5 i|s|A^ jw? %''N>». f' V Vv i+iZfj" ':■-■■■-m ITS" trfT" l"0 J^V** -oo^T V, J 4k ,a"° D f.c f www.supernature.com.sg Camden Medical Centre Park House Condominium Four
      153 words
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      56 3 munchu'5 TM bite me 1 KO tff -4 p** M* S>r '/f 0 2 serving Be disciplined. Snack consistently. Snacking between meals keeps your energy level up. You'll never go hungry or overindulge at mealtimes. Co ahead. Insist on your right to snack. Munchy's Oat Krunch. Made from wholesome oats,
      56 words
Page thumbnail Page 4/5
  • Page 4/5 Advertisements
    • Advertisement
      Lock icon Page 4/5 Advertisements Column 1
      597 4/5 GOODMORNING Findouthowtoturnthemostimportant mealofthedayintothemostinteresting HAVEyouhadyour breakfastyet? It’s themeal thatcomes beforeyour daybegins, perhapsafter anightof partying,andit deservesour attention. Agoodbreakfast islikea getting-out-of-bed stretch:If youhavea good one,chances are,you’ll havea brilliantday. Sowhat’sgood? Thereis thetraditionalfavourite,dim sum. But someeateries aredetermined tomake itnewand giveita twist. Seepage 24 forideas. Butifyou’re a stickler fortheconventional, wehighlight thetraditional onestooon page28. Foodcourts– theheart of
      597 words
Page thumbnail Page 6
  • Page 6 Advertisements
    • Advertisement
      Lock icon Page 6 Advertisements Column 1
      175 6 Xie Chun T op- p™duct s m* (£§V/j rv« TASTY Kavu Kavli > S* Kavli Checkout the wide range of products we import and export www.xiechun.com. CRISPBREAD JS Wpm BORG S Family Favourites nevana since 1899 NATURAL PROCESSED CHEESE Bulla Hevai^ in FINE PASTRIES PTY LTD BUJE t.-I. GARLIC BU
      175 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 2
      199 6 Freshly Made Real Yogurt [3EHJ THICK AND CREAMY YET 97% FAT FREE! Wake Up Healthy! 97% Fat Free High in Calcium 100% Natural Rich in Protein Not Frozen to Maintain Excellent Texture Available at these outlets AngMoKio Hub #02-66 Choa Chu Kang Lot 1 Shoppers'Mall #B1 -23 Downtown East E-Hub!
      199 words
Page thumbnail Page 7
  • Page 7 Advertisements
    • Advertisement
      Lock icon Page 7 Advertisements Column 1
      306 7 HWf/AAt Square ist Hour Free PARKING -sMk 1 &> L* J T ANT A L I S I N G GREAT Promotion valid from 18 April to 16 May 2010,6am 11am only Dine-in only Valid at Kopitiam Square only Items are whilst stocks last Additional charges for take-away apply I
      306 words
Page thumbnail Page 8/9
  • Page 8/9 Advertisements
    • Advertisement
      Lock icon Page 8/9 Advertisements Column 1
      445 8/9 ORGANIC OPTIONS Organic poridgein yourpot Ahealthybreakfastisa greatwaytostarttheday.Withorganicandhealthfoodnowin demand,weintroduce someoptions SuperNaturestocksanextensive rangeoforganicandnatural products. StartyourdaywithRude Health’sorganicporridge($10.95,550g).Thisproduct containsaddedfruitpiecessuchasdates,apricotsand apple. It’shighinfibreandhasnoaddedsaltorsugar.Thegrains arealsonotgeneticallymodified. CoupleyourbreakfastwithTheBridge’sBioRiceDrink ($10.55).MadeinItaly,itcomesinapackofthree200ml packets. Madeusing100percentorganicallygrownItalianrice,it’s analternativeforthoseallergictocowmilkandsoyamilk. SUPERNATURESTORE Address:#01-21/23/27ParkHouse Tel:*****338 Openinghours:10amto7pmfromMondaystoSaturdays, 10amto6pmonSundays,10amto5pmonpublicholidays Ohsomanyjoysforsoy Nothingfishyaboutmilk Thisproduct haslowfatand sugar contentand ischolesterol-anddairy-free. It also containsproteinsand ishigh incalcium. Thehealth-consciouscan gofor theno-cane-sugar alternative. Eachvariant comespackagedina 500g refill pouch ($8.90)ora
      445 words
Page thumbnail Page 10
  • Page 10 Advertisements
    • Advertisement
      Lock icon Page 10 Advertisements Column 1
      74 10 Iff f. JL faa NG AH SIO Bak Kut Teh 208 Rangoon Road Singapore *****3 Tel: 6291 4537 www.ngahsio.com A Opening Hours 7am to 3 pm daily (Closed on Monday) if** -r> t > V I i"2 IS* w w m V. Jumbo Prawn Noodle tk V Pork Ribs Noodle
      74 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 2
      131 10 m h T~ V V»r *w v i >'••.•! a® Signature Claypot Bak Kut Teh I war p sm. Braised Pig s Trotter J C; Wa '< 1® Claypot Organ Soup v 9272 6086 Blk848Yishun Street 81 #01-136 8139 6015 Business Hours: 10.30am 10.30pm yfgw/Wng Restaurant (Nonya F 63-65 Serangoon
      131 words
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      81 11 ovvhead iQI <v \o <=> N s (owhea^G whead {owhead z STRAV.BLRRt FLAVOURED MILK O PURE LK LOW FAT HIGH CALCIUM V\ PREMIUM 1 CHOCOU MILK PURE MILK FAT FREE fOQU NATURAL?""*". HIGH CALCIUM TT t vSi Si Lr\ rrtou NATURAL FRCSHUU* k FROM NATURAL FRESH MILK MM I f
      81 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 2
      88 11 ovvhead Organic Rolled Oats for your Extra Boost of Energy! Passion for a healthier lifestyle. Cowhead Organic Rolled oats deliver to you that extra needed boost for a great morning start. They have been pre-cooked and then dehydrated. High in soluble fibre, which is better known as Beta Glucan, it
      88 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      383 12 Breakfast tips WHEN having breakfast, moderation is key. Don’tjust indulge, butstart your morning with a healthier meal. Gleneagles Hospital dietician Ms Mah Wai Yee has some tips: Tip1: Give your meals a healthier balance with vegetable juice or a cup of fruit for fibre. Tip 2: Ask for less condiments.
      383 words
Page thumbnail Page 13
  • Page 13 Advertisements
    • Advertisement
      Lock icon Page 13 Advertisements Column 1
      45 13 Kaya Specialist 0 i. 4 I: t *Z'i r m. L* L, w 2 f w i xV1 >>< in/., Fo VSW} 'us v** No Artificial Preservatives, "Trans Fat Free" v. Tel: 6779 5132 Fax: 6777 4058 www.singaporekaya.com Blk V #01-163 Pandan Loop, Singapore *****4 SINGAPOREl
      45 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 2
      119 13 "The goodness of Fibfe So Lite, so right for me.' Wong Li Lin Businesswoman, Mother FLY Entertainment Artiste V > 1 f"t. Added Fibfe 25% Less Sugar Low Fat Striking the perfect balance between work and personal life isn't easy. Which is why I reach for Horlicks 3in1 Lite. It
      119 words
Page thumbnail Page 14
  • Page 14 Advertisements
    • Advertisement
      Lock icon Page 14 Advertisements Column 1
      372 14 JAPANESE PORK SAUSAGE Fully cooked, just heat up serve Extra Lean recipe, more meat content Sausages has been slit for convenience on frying Healthy sausages perfect for kids. TATSUMOTO tatsumoto TAY ■ru.iimrrqi TM SI snrs Chipolata poffX~\V\ Extra Extra Lean Lean Extra Net Extra 250g Sht Net Lean Lean 2S0g
      372 words
Page thumbnail Page 15
  • Page 15 Advertisements
    • Advertisement
      Lock icon Page 15 Advertisements Column 1
      208 15 UN I SOY Instant Organic Soya Milk The Perfect Blend of Nutrition and aste UNISOY® Instant Organic Soya Milk offers great nutritional benefits in a delicious and convenient way to ensure that you and your family enjoy all the best that life has to offer! 100% Pure Goodness Only made
      208 words
Page thumbnail Page 16/17
  • Page 16/17 Advertisements
    • Advertisement
      Lock icon Page 16/17 Advertisements Column 1
      239 16/17 TrueblueM’sian loveshernasi lemakhomemade LawrenceWong andKannyThenghavesomethingin commonwhenitcomes totheirbreakfast–fruit.Lots ofit withtheirbreakfast. ABEAUTIFULSTART TOTHEMORNING cerealworksaswell. Hesaid:“Ilikeporridge,but(I’llhave)cerealwhenIhaveto rushforshoots.” It’sadifferentstoryifhehasthetime. “I’llgosomewhereproperandhaveporridge. “Ifthere’swontonnoodlesI’llhavethatforbreakfastas well.” Lawrencehaddifferentpreferenceswhenhewas youngerthough. Hisfavouritechildhoodbreakfastwaseggsthathis mothermade,placedbetweenbread. “Mymumwouldplacefriedegginbetweentwoslicesof bread.Ilikethat,”hesaid. Andfruitsareatopchoicetoo. “Fruitshavealotoffibre.It’sagreatwaytostarttheday. Maybetheactionofmunchingonthefruitwakesmeup,it’s likeawarm-upexercisefortheday.” Foractress/hostTheng–currentlyseenonChannel8’s YourHandsinMine–fruitsareanadditiontobreakfast. The23-year-oldsaid:“IlikeinstantoatmealandIadd bananas,grapesandespeciallystrawberriestoit. “Strawberriesaremyfavourite.” Thestrawberryloveralsoblendsavocadowithskimmed milkforbreakfast. Thengsaid:“It’sverytasty!” Modelscertainlyknowhowtomakeamealoutofit Wespeaktomodelsand celebritiesaboutwhat theylikeforbreakfast DOBEAUTIFULpeopleeatbreakfast? Ofcoursetheydo! Sowhatturnstheseactorsandmodelsoninthe morning?Wefindout: LAWRENCEWONG&KANNYTHENG TheseWaWaArtistesNetworkstarsarefreshfacesonTV andtheyarebigonbreakfast. Wong,28,isoneofthe10nomineesinthisyear’sStar Awards’“FavouriteMaleCharacter”categoryforhisroleChen WenYuanintheChannelUtelemovieThePromise.
      239 words
Page thumbnail Page 18
  • Page 18 Advertisements
    • Advertisement
      Lock icon Page 18 Advertisements Column 1
      323 18 GET A SOLID START TO YOUR DAY THE ROTI PRATA HOUSE PTE LTD The B>est Cris-pw "Prata Recommended by The New Paper I We know the way to your heart is through your stomach at Roti Prata House. We not only serve you the best prata but a variety of
      323 words
Page thumbnail Page 19
  • Page 19 Advertisements
    • Advertisement
      Lock icon Page 19 Advertisements Column 1
      355 19 Savor w 4i jb > fifiJ t 'V. rAeJJL^JJL W of Richness r Fortunate R beginning with a Sumptuous Breakfast It's no secret that one's health makes his wealth, so spins the wheel of fortune, as good health brings one greater wealth. At Fortunate Restaurant, have yourself treated to a
      355 words
Page thumbnail Page 20
  • Page 20 Advertisements
    • Advertisement
      Lock icon Page 20 Advertisements Column 1
      812 20 > J 1 Xin Char lou If tucking into exquisite dim sum is your idea of a perfect breakfast, you definitely must check out Banquet Holdings'outlet at Balestier MarketXin Char Lou. Using only the freshest premium ingredients, their Hong Kong chef prepares a daily range of mouth-watering delicacies like Steamed
      812 words
Page thumbnail Page 21
  • Page 21 Advertisements
    • Advertisement
      Lock icon Page 21 Advertisements Column 1
      680 21 k k Breakfast Cowhead The benefits of cow's milk are well known, so breaking your nightlong fast with a glass of this beverage is a good way to start your day. Cowhead UHT Milk distributed by Ben Food is made from 100 per cent pure cow's milk from New Zealand
      680 words
Page thumbnail Page 22
  • Page 22 Advertisements
    • Advertisement
      Lock icon Page 22 Advertisements Column 1
      400 22 HOCK HAI (HONG LIM) CURRY CHICKEN BEE HOON NOODLE Most Famous Dish Curry Chicken Bee Hoon Noodle Opening hours: 10am to 11.30pm Daily HP 9786 8624 for orders ZlLO P □□r Xj (CCCCCCCC Bn nuivm nB Uff /?aw F/S/J Yee Mee Mee Sua Peanut Minced Meat Congee Pork Congee Chichen
      400 words
Page thumbnail Page 23
  • Page 23 Advertisements
    • Advertisement
      Lock icon Page 23 Advertisements Column 1
      120 23 I I j&f V® RED STAR Restaurant Blk 54 Chin Swee Road #07-23 S(*****4) Tel: 6532 5266/ 6532 5103 Business Hours: 7am-3pm 6pm-llpm TIM SUM PUSH from 7am to 3pm T f OA > 7 00 m 5a J f i h I v 1 Af V J: <***» i
      120 words
Page thumbnail Page 24/25
  • Page 24/25 Advertisements
    • Advertisement
      Lock icon Page 24/25 Advertisements Column 1
      357 24/25 Abreakfromtheusualfeast BOREDoftheusual?Innovationisalwaysinteresting. Herearetwoplaceswithnewdishesforyoutotry: XINCHARLOU Address:411BalestierRoad Tel:*****859 Openinghours:7.30amto3pmand6pmto10pmon weekdays,7.30amto10pmonweekendsandpublic holidays ($2.80,twopieces). Thecrispyskinismadefromricewiththesteamy,tasty prawnfillinginside.It’saninnovativecombinationwiththe smallpieceofmangointhemiddle. Forthefishlovers,youcantrythesteamedsliced garoupacabbageroll($2.80,twopieces). Savourthesucculentfishfilling. Feastyoureyesonthepan-friedsweet potatowithredbeanpaste($2.30,three pieces). Fashionedintotheshapeofapumpkin, thesepetitetreatscanonlybefoundinXin CharLouinSingaporesofar. What’salsointerestingisthecrispy springrollwithvegetable($2.30,three pieces). Ithasyam,radish,spinachandcarrot. Thesoft,yummyyampasteaddsflavour tothespringrollandtakingawayanyoily feel. Butifyouwantthetraditional,the restaurantalsooffersthesteamedraddish cake($1.80,onepiececutintotwo). Thepickledlettucebitsanddried shrimpsprovidethedishwithanadded saltytinge. Ithasasofttexturewithaddedflavour bytheseafoodsauce. (Right)XinCharLou’s Japanese-styledseaweed roll. (Below)XinCharLou’sdeepfried mangorollwith prawns. JALAN KAYUTHE PRATA CAFE Address:60B Orchard Road,
      357 words
Page thumbnail Page 26
  • Page 26 Advertisements
    • Advertisement
      Lock icon Page 26 Advertisements Column 1
      246 26 NEUTAP One of the World's leading 4-in-l Water Processor with Concentration Valve Demo at Showroom neu TRP a til «399 1) Alkalize 2) Ionize 3) Mineralize 4) Purify No electricity required. Costs $0.09//versus $0.42// dispenser $2.60 bottled water. Any trade-in system-Get Neutap@$375. Suitable for home, office factory. Inflo Health Sciences
      246 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 2
      242 26 KiWly HoAdLnvule ~T7/«r» S<AJT HIT BY HUNGER PANGS in the middle of the night? Not sure where to go for a scrumptious breakfast? Find all kinds of delicious snacks at Kimly Tim Sum all day long. The dim sum items here are all handmade to ensure freshness. Whether you like
      242 words
Page thumbnail Page 27
  • Page 27 Advertisements
    • Advertisement
      Lock icon Page 27 Advertisements Column 1
      43 27 HONG KONG DIM SUM BREAKFAST UNDER ONE ROOF AT BALESTiER MARKET Sl It WKJT L tvmmt TON NOOD f J3>J J> <S> %r H/e^ ov <s m VDj^rr <?±<5> 0 <$> n Ca Pa/-/r M V Visit us 411 Balestier Road 24Hrs Singapore *****0
      43 words
Page thumbnail Page 28/29
  • Page 28/29 Advertisements
    • Advertisement
      Lock icon Page 28/29 Advertisements Column 1
      255 28/29 DIMSUM FAMILYFEAST Wefoundtwoplaces thatdodimsumwith atouchoftradition Goodcheecheongfunisonewherethericesheetisso thinthatyoucanseethecolourofthefillingwrappedunderit. There’sscallop($4.00),prawn($4.00)orcharsiew ($3.60)forthefilling.Theprawncheecheongfunisverywell done. Butwhattakesthecakeistheuniquebigbao($4.40). Aboutfourtimesthesizeoftheusualbao,it’sbigenough fortwoorthreepeopletoshare.Ithasachickenandpork filling,withasaltedduckyolkinitscentre. TheCantonese-stylecenturyeggcongee($3.60)isalsoa favouriteamongpatrons. Therestaurant’straditionalCantonesesettingmakesthe mealevenmorememorable. DecoratedwithwoodenChinese-styledpanelswith Cantonesesongsplayinginthebackground,RedStaris reminiscentofthegoodolddays. Thevegetarianmeatandmushroomfillingsgivethe dumplingsajuicy,succulenttaste. ADIMSUMbreakfastisagreatwaytospendtimewith thefamily. Andifyoulikeitthetraditionalway,herearetwo placesyouwilllike. FortunateRestaurantservesover100dimsumdishes. There’sanearlybirddiscountof15percentoffallfood items,excludingdrinks,from8amto10amonweekdaystill May19. Firstupwastheglutinousriceinlotusleaf($3.50,one piece).Thelotusleaflentaspecialaromatotherice.It’snot toooily. Thericehadasmoothtextureandwentwellwiththe chewychickenmeat,mushroomandChinesesausage fillings. There’salsochickenwrappedwithpaper($4,two pieces).Thechickenisfirstmarinatedwithsesameoiland gingersauce. It’sthenwrappedingrease-proofpaperanddeepfried, yieldingasavouryandflavourfulconcoction. OneofXinCharLou’smoreuniquedumplingscomeinthe formofagoldfish($4,twopieces). Thesepetitedumplingslookattractivebecauseoftheir brightorangeskin.Themeatyprawnfillingmakesitvery tasty. Don’tmissFortunate’ssteamedcrystalmushroom dumplings($3.50,threepieces). Thisstandsoutamongtheusualprawnormeatfareand
      255 words
Page thumbnail Page 30
  • Page 30 Advertisements
    • Advertisement
      Lock icon Page 30 Advertisements Column 1
      117 30 0 L V <3 7" D09S7 $199 oo S3 U.P 238.00 TO2024 v—7 S/STEEL-BLACK BREAD MAKER I 750gm/900gm BREAD 600W Detachable lid with viewing window. w i t n« pTffijsp I av. Detachable non stick baking sett pan with handle. Keep thejbread warn Fully automatic kneading and hour baking baking
      117 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 2
      57 30 44 -wM :»a M t*. v. > •^R T* Ik •dvid V 1 n TVcuttoa /foodie o r □QUIZ □□nn KIM PENG HIANG FOOD INDUSTRY (PTE) LTD. FIRE BRAND (04i>MA ■i'f <& <«•■■■'«., FIRE BRAND swwm mm Fire Brand Pork Floss XMMft Pork Floss Available at Wet Markets, Mini Supermarkets
      57 words
Page thumbnail Page 31
  • Page 31 Advertisements
    • Advertisement
      Lock icon Page 31 Advertisements Column 1
      276 31 1 i V Home deliveries to selected locations are available with a minimum order of 1.6 litres. H ay Dairies Locally produced PURE GOAT MILK Pasteurised and Homogenised. The Healthier Choice. Goat milk is a fresh, pure and nutritious beverage, absolutely natural and contains no additives. It is the ideal
      276 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 2
      95 31 Healthy, Delicious Breakfasts New! GOLEAN Crisp! Golean Crisp Toasted Berry Crumble 3 9 -I. ■r *4 Kasfii The Seven Whole Grain Company u Kashi Blackcurrants Walnuts New! PE'W W ORM&I 'ORGANIC, 0RG^ Honest Super Food Smoothie Qurliei Cr-a. fres Cr^.fres UWtts HONEST tflOOTMK 'v'.v HONEST HONEST r Organic Orange Organic
      95 words
Page thumbnail Page 32
  • Page 32 Advertisements
    • Advertisement
      Lock icon Page 32 Advertisements Column 1
      618 32 Advertisement Feature A GREAT WITH A GREAT A fulfilling breakfast not only gives you more energy for the day ahead, but can even help you perform better at work. WRITTEN BY: STEPHEN KWOK As the first meal of the day, breakfast sets the tone for your body. It fills you
      618 words