The Straits Times, 22 May 2013, Afternoon Edition

Lock icon This issue may only be viewed from the multimedia stations at NLB Libraries. See FAQ for more information.

Microfilm: NL32592
Total Pages: 127
1 34 The Straits Times
Page thumbnail Page 1
  • Title Section
    Lock icon Masthead
    28 1 THE STRAITS TIMES SINCE 1845 WEDNESDAY, MAY 22, 2013 134 PAGES IN FIVE PARTS TO SUBSCRIBE: 6388-3838 www.sphsubscription.com.sg 90 cents A Singapore Press Holdings publication MCI (P) 050/02/2013
    28 words
  • Article, Illustration
    Lock icon Massive tornado flattens Oklahoma City neighbourhoods
    335 1 ASSOCIATED PRESS AGENCE FRANCE-PRESSE BLOOMBERG MOORE (Oklahoma) A monstrous tornado more than 3km wide roared through an Oklahoma City suburb flattening neighbourhoods with winds up to 320kmh, destroying at least one school, and burying dozens beneath the devastation. As the death toll which had
    ASSOCIATED PRESS; AGENCE FRANCE-PRESSE; BLOOMBERG; PHOTO: ASSOCIATED PRESS  -  335 words
  • Article, Illustration
    Lock icon Dramatic twists in coroner’s inquiry
    151 1 THE court was set to hear from a key witness who was the last person to see American researcher Shane Todd alive. But the State Coroner’s decision to dismiss his family’s request to have Dr Luis Alejandro Andia Montes stand down to the next day,
    151 words
  • Article, Illustration
    Lock icon DBS allowed only 40% stake in Danamon
    53 1 THE governor of Indonesia’s central bank stopped short of approving the DBS bid for a controlling stake in Jakarta-based Bank Danamon. Instead, a maximum 40 per cent stake will be permitted, in keeping with the country’s revised banking regulations. L TOP OF THE
    53 words
  • Article
    Lock icon Obama, Xi set to build rapport at retreat
    549 1  -  Earlier-than-expected meeting reflects sense of urgency, say observers By KOR KIAN BENG CHINA BUREAU CHIEF IN BEIJING kianbeng@sph.com.sg CHINESE President Xi Jinping and United States President Barack Obama are set to hold their first-ever retreat next month in California, in an effort
    549 words
  • Page 1 Advertisements
    • Advertisement
      Lock icon Page 1 Advertisements Column 1
      225 1 SOCIAL STAR AWARDS PREMIUM TICKET WINNERS TOP OF THE NEWS A9 TUMBLR FOUNDER DAVID KARP HIGH SCHOOL DROPOUT MAKES GOOD WORLD A29 FAST FURIOUS SERIES B-MOVIE TO BLOCKBUSTER LIFE! C4&5 S’PORE SELECTION V ATLETICO MADRID SPANISH TREAT FOR FANS SPORT B26 8"*****1"*****7 NO NEED TO QUALIFY Ingenieur Double Chronograph Titanium.
      225 words
Page thumbnail Page 2
  • TOP OF THE NEWS
    • Article, Illustration
      Lock icon Obama hails Thein Sein’s efforts at reform
      459 2 Myanmar leader gets assurance of US support, signs trade deal with US ASSOCIATED PRESS WASHINGTON President Barack Obama told Myanmar’s President during a long-awaited White House visit that he appreciates the leader’s efforts to lead the country on its long, and sometimes difficult
      ASSOCIATED PRESS; PHOTO: AGENCE FRANCE-PRESSE  -  459 words
    • Article, Illustration
      Lock icon Myanmar’s road to democracy not without challenges
      543 2  -  NEWS ANALYSIS By TAN HUI YEE THAILAND CORRESPONDENT tanhy@sph.com.sg IN HIS landmark visit to the United States, Myanmar President Thein Sein made all the right noises: He called for an end to intercommunal violence and a national identity that would include people from
      543 words
    • Article
      Lock icon DBS gets approval for 40% Danamon stake
      524 3  -  Jakarta move puts pressure on MAS to grant its banks more access: Observers By ZUBAIDAH NAZEER INDONESIA CORRESPONDENT IN JAKARTA zubaidah@sph.com.sg Additional reporting by Wahyudi Soeriaatmadja in Indonesia and Magdalen Ng in Singapore THE governor of Indonesia’s central bank stopped short of approving
      524 words
    • Article, Illustration
      Lock icon Fire at Traffic Police HQ damages nine motorcycles
      317 3  -  By FABIAN KOH fabkoh@sph.com.sg A FIRE broke out at the Traffic Police headquarters along Ubi Avenue 3 yesterday. The Singapore Civil Defence Force (SCDF) received a call at 1pm, and sent a fire engine, one Red Rhino, and two fire bikes to
      PHOTO: STOMP  -  317 words
    • THE NEWS IN 5 MINUTES
      • Article
        Lock icon Obama-Xi retreat next month
        48 4 A MEETING between Chinese President Xi Jinping and US President Barack Obama is set to take place in California next month, earlier than expected. The development reflects a mutual sense of urgency to tackle both global and bilateral issues, observers say. TOP NEWS A1
        48 words
      • Article
        Lock icon Support for KL-S’pore rail link
        37 4 MALAYSIA’S Foreign Minister Anifah Aman said the proposed high-speed rail link between Singapore and Kuala Lumpur is looking “very, very attractive”, though discussions on the finer details are needed. TOP NEWS A8
        37 words
      • WORLD
        • Article
          Lock icon China bloggers reborn
          44 4 OUTSPOKEN microbloggers in China who have their accounts shut down, usually on the orders of the authorities, have been trying to overcome the censors by repeatedly “reincarnating” themselves using new names on Weibo, the nation’s massively popular Twitter-like service. PAGE A10
          44 words
        • Article, Illustration
          Lock icon Pushing for peace
          83 4 INDONESIA’S former vice-president Jusuf Kalla has been cranking up efforts to promote peace and reconciliation beyond his country’s borders. The moves, including a visit to Malaysia to help mend relations between political rivals in the aftermath of the general election, could signal the 71-year-old statesman’s desire to
          ST PHOTO: WAHYUDI SOERIAATMADJA  -  83 words
        • Article
          Lock icon Tracking foreigners’ exit
          61 4 A US Senate committee has voted in favour of fingerprint technology at airports and ports to check the movements of immigrants and other foreigners leaving the United States. It wants the first installed at the 10 busiest US airports within two years. Supporters claim that the departure
          61 words
      • Article
        Lock icon CHINA SEEKS DIPLOMATIC INFLUENCE
        54 4 China’s offer to mediate the Israel-Palestine dispute may be more indicative of policy change than meant to be taken literally. It seeks diplomatic influence where, before, it has been content to develop only its economy and military. The change will be good for the world. The
        54 words
      • OPINION
        • Article
          Lock icon ‘Relook Aussie security’
          48 4 AUSTRALIA depends on America today just as much as it depended on Britain a century ago. With the United States’ primacy in Asia being challenged by the rise of China, Australia needs to relook its security assumptions, writes By Invitation columnist Hugh White. PAGE A30
          48 words
      • HOME
        • Article
          Lock icon Take a virtual tour
          56 4 GOOGLE users will be able to take a peek inside about 400 businesses and heritage sites in Singapore with the help of a new “virtual tours” service. They can “walk” through shops or restaurants using the feature, which is due to be launched here at the
          56 words
        • Article
          Lock icon SIA-Shenzhen tie-up
          47 4 SINGAPORE Airlines has signed its first code-share deal with a Chinese carrier. The tie-up between SIA/SilkAir and Shenzhen Airlines means the companies can sell seats on each other’s services. This doubles the SIA group’s capacity to two return flights a day to Shenzhen. PAGE B9
          47 words
      • MONEY
        • Article
          Lock icon Cooling measures ‘vital’
          36 4 THE use of macroprudential policies, such as the recent property cooling measures, is becoming increasingly important in an era of cheap money, said Monetary Authority of Singapore managing director Ravi Menon. PAGE B13
          36 words
      • SPORT
        • Article
          Lock icon Special One moving on
          62 4 JOSE Mourinho is poised to return to former club Chelsea, after agreeing by mutual consent to leave Real Madrid early next month. His last of three seasons at the Spanish giants has been blighted by team divisions and a lack of silverware, and the Special One
          62 words
      • LIFE!
        • Article, Illustration
          Lock icon Bringing style to show
          77 4 TRANSGENDER model Amanda Lepore had her account on photo-sharing social media site Instagram suspended twice after she posted what were deemed racy pictures of herself. The 45-year-old American blonde bombshell brings her sometimes provocative, always sensational style to tomorrow’s inaugural Social Star Awards at Marina Bay
          PHOTO: STARCOUNT  -  77 words
        • Article, Illustration
          Lock icon SNL Korea: Jay’s excited
          92 4 THE Seoul-based Korean-American rapper Jay Park is not worried in the least that his Saturday Night Live (SNL) Korea’s hosting gig will conflict with his music persona. He is excited about his role on Saturday Night Live Korea, a franchise of the iconic long-running American comedy
          PHOTO: XMI PTE LTD  -  92 words
      • straitstimes.com
        • Article, Illustration
          Lock icon Traffic Police HQ fire
          64 4 VIEW a picture gallery and watch a video of the fire at the Traffic Police headquarters in Ubi Avenue 3 yesterday. No one was injured but nine motorcycles within the compound were damaged in the fire. The fire at the Traffic Police headquarters sending thick black
          PHOTO: STOMP  -  64 words
        • Article
          Lock icon Towering Skytree
          42 4 ONE year, more than 50 million visitors, and a wait of at least six hours. Tokyo Skytree the world’s tallest free-standing tower marks the first anniversary of its opening today and the 634m tower has seen some eye-catching numbers. www.stasiareport.com
          42 words
        • Article
          Lock icon Tornado hits Oklahoma
          38 4 WATCH videos and view pictures of the monstrous tornado that swept through southern Oklahoma City yesterday. It ripped through the suburb of Moore in a Midwest region of the United States known as Tornado Alley.
          38 words
        • Article, Illustration
          Lock icon Tickets for concerts
          26 4 ARE you one of our 120 grand prize ticket winners for the Social Star Awards and Singapore Social Concerts? Find out on stcommunities.straitstimes.com
          26 words
      • razortv.com.sg
        • Article, Illustration
          Lock icon Birds versus planes
          50 4 CHANGI Airport uses loudhailers to blast bird calls on the runway to prevent collisions between wildlife and aircraft. Watch this video to see how it works. An airport operations officer using a loudhailer to blast bird distress calls at Changi Airport. ST FILE PHOTO ST FILE PHOTO
          ST FILE PHOTO  -  50 words
        • Article
          Lock icon Is chivalry dead?
          25 4 SINGAPOREANS say they are not surprised that there are few knights in shining armour here as Asians tend to be more shy.
          25 words
        • Article
          Lock icon Sleepless in Singapore
          23 4 FEELING tired all the time? Unable to concentrate on work or school? Chances are, you have not been sleeping well.
          23 words
      • stomp.com.sg
        • Article
          Lock icon Dangerous behaviour
          31 4 STOMPER Ng was concerned about the safety of a group of photographers who were squatting at a zebra crossing near a bus interchange to take photos of passing vehicles.
          31 words
    • Article
      Lock icon US witness changes part of initial findings
      739 6  -  He now agrees Todd was not strangled with a cord, but maintains he was killed AMERICAN RESEARCHER’S DEATH By FENG ZENGKUN zengkun@sph.com.sg THE expert witness who said that American researcher Shane Todd was murdered changed part of the findings in his post-mortem report
      739 words
    • Article, Illustration
      Lock icon Todd family walk out of court as witness is set to testify
      627 6  -  By LIM YAN LIANG yanliang@sph.com.sg THE court was set to hear from a witness yesterday, who was apparently the last person to see American researcher Shane Todd alive. But State Coroner Chay Yuen Fatt’s decision to dismiss his
      ST PHOTOS: SEAH KWANG PENG  -  627 words
    • Article, Illustration
      Lock icon Interns ‘worked in fear’ at software firm
      541 6  -  By AMELIA TAN, MARYAM MOKHTAR ameltan@sph.com.sg maryamm@sph.com.sg Additional reporting by Joanna Lee THE software company supervisor at the centre of an employee abuse scandal is facing new allegations from two former interns. The two women approached the media to tell how they “worked
      PHOTOS: LIANHE WANBAO  -  541 words
    • Article
      Lock icon Rape accused defends marriage to 13-year-old
      446 6 THE STAR/ASIA NEWS NETWORK KOTA KINABALU In a case that shocks Malaysia, a 40-year-old man charged with raping a 13-year-old girl and marrying her in the midst of the case said he saw nothing wrong with his actions. Riduan Masmud, a restaurant manager and
      THE STAR/ASIA NEWS NETWORK  -  446 words
    • Article, Illustration
      Lock icon S’pore-KL high-speed rail link looking ‘very attractive’
      572 8  -  Malaysian Foreign Minister in update says finer details need discussions By LESTER KONG MALAYSIA CORRESPONDENT IN PUTRAJAYA lestkong@sph.com.sg THE proposed high-speed rail link between Singapore and Kuala Lumpur is looking “very, very attractive”, though further discussions on the finer details are needed, Malaysian
      PHOTO: REUTERS  -  572 words
    • Article
      Lock icon KL grappling with challenges of post-ISA anti-terror law
      494 8  -  By TEO CHENG WEE REGIONAL CORRESPONDENT IN KUALA LUMPUR chengwee@sph.com.sg THE release of the first three Malaysians detained under a new anti-terrorist law shows the new challenges presented to the authorities here in nabbing terrorists, experts say. The High Court’s dismissal of
      494 words
    • Article
      Lock icon Mum and son win premium tickets
      477 9  -  They are among the 10 winners of tickets to Social Star Awards and concerts By JOANNA LEE ljoanna@sph.com.sg WHEN Mr Dale Yeoh found out he had won premium tickets to the Social Star Awards and the Singapore Social Concerts, it was his mother who
      477 words
    • Article, Illustration
      Lock icon ST SuperFan contest winners
      163 9 MORE than 200 creative multimedia entries were submitted for the Ultimate ST SuperFan contest. Here are the winners: Winner of the No. 1 SuperFan prize comprising a $3,000 hair, make-up and clothes makeover, a red carpet walk at the awards ceremony, entrance to the post-awards party
      ST PHOTO: ASHLEIGH SIM  -  163 words
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      153 2 TM www.easb.edu.sg East Asia Institute of Management Sj rt 5 5 2. I g i ec > Possible completion in 12 months! (with relevant polytechnic qualification) Quarterly intakes available! Full time Part time mode of study available! Flexible instalment plan! Wide range of undergraduate disciplines to complement your specialisation >
      153 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 2
      170 2 energise your meetings Wzm leave the rest to us a Meeting packages from $50 wv per person Corporate dinner packages 648 per table of 10 persons Complimentary AV equipment (one LCD projector and one wireless microphone) for events booked and held before 31 August 2013. Meetings will never be the
      170 words
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      579 3 Start the day knowing that a full year's interest awaits you at the end of it. Introducing the ANZ Instant Interest Time Deposit, a deposit that pays you the full interest on the same day. With attractive interest rates of up to 1.75% p.a., you can enjoy the rewards of
      579 words
Page thumbnail Page 4
  • Page 4 Advertisements
    • Advertisement
      Lock icon Page 4 Advertisements Column 1
      139 4 TOMORROW IN THE STRAITS TIMES PRINT ONLINE International recognition for NIE chief and S’pore teachers Fast-track to a bachelor’s degree with our diploma. It’s possible. As one of Singapore’s top private education institutions, we have been making it possible for students since 1964. Now, you can also pursue your full-time
      139 words
    • Advertisement
      Lock icon Page 4 Advertisements Column 2
      21 4 STRAITS TIMES ONLINE MOBILE WEBSITE www.straitstimes.com TWITTER @stcom FACEBOOK www.facebook.com/thestraitstimes Get ST on your smartphone apps Asia’s No. 1 news website
      21 words
Page thumbnail Page 5
  • Page 5 Advertisements
    • Advertisement
      Lock icon Page 5 Advertisements Column 1
      24 5 OYSTER PERPETUALSUBMARINER DATE IN IS CT WHITE GOLD EMPEROR WATCH AND JEWELLERY THE SHOPPING GALLERY AT THE HILTON, #01-03/04. TEL: 6737 2896 t ROLEX
      24 words
Page thumbnail Page 6
Page thumbnail Page 7
  • Page 7 Advertisements
    • Advertisement
      Lock icon Page 7 Advertisements Column 1
      303 7 A checking and savings account/should earn you money, not cost you. $ur -prise, surprise 1 We believe that a checking and savings account shouldn’t cost you a cent. In fact, you should be earning interest right from your first dollar. That’s why unlike other promotional rates that come and go,
      303 words
Page thumbnail Page 8
  • Page 8 Advertisements
    • Advertisement
      Lock icon Page 8 Advertisements Column 1
      144 8 Samsung recommends Windows 8 Smile. amsung Sur From now till 31 May 2013 e a >|V, S Sr T HR Samsung SERIES 9 IBP n There's plenty to smile about with the host of surprise gifts when you purchase selected Samsung Notebooks. Plus, the style, power and performance you’ve come
      144 words
Page thumbnail Page 9
  • Page 9 Advertisements
    • Advertisement
      Lock icon Page 9 Advertisements Column 1
      33 9 1before you can catch Aerosmith! more day SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column
      33 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 2
      55 9 DREAM THE IMPOSSIBLE, BELIEVE THE UNBELIEVABLE, NEVER TAKE ‘NO* FOR AN ANSWER. a Catch Tony on The Apprentice Asia The Man Behind AirAsia as he puts Asia’s smartest to the test. World Premiere: 22 May, 9.05pm only on Get ready to be fired. AirAsia is an Official Sponsor of: Join
      55 words
Page thumbnail Page 10
  • WORLD
    • Article, Illustration
      Lock icon Reborn on Weibo: again and again
      800 10  -  Outspoken bloggers on Chinese site whose accounts get deleted ‘reincarnate’ themselves by adopting different user names By KOR KIAN BENG CHINA BUREAU CHIEF IN BEIJING kianbeng@sph.com.sg FOR many outspoken critics on China’s massively popular Weibo microblogging platform, having their accounts shut mysteriously, mostly at
      PHOTOS: REUTERS, IMAGINECHINA  -  800 words
    • ASIA
      • Article
        Lock icon Li seeks closer economic ties with India
        569 11  -  Chinese Premier wants more balanced growth in bilateral trade By NIRMALA GANAPATHY INDIA CORRESPONDENT IN NEW DELHI gnirmala@sph.com.sg CHINESE Premier Li Keqiang is pushing for stronger economic ties with India, saying that aligning the markets of Asia’s fast-est-growing economies will benefit both countries
        569 words
      • Article, Illustration
        Lock icon Li visits revered doc’s family
        285 11 AGENCE FRANCE-PRESSE MUMBAI China’s Premier paid respects to the family of an Indian doctor who died treating Chinese troops more than 70 years ago, becoming a rare symbol of friendship between the two nations. Mr Li Keqiang, like Chinese leaders before him, took time out
        AGENCE FRANCE-PRESSE; PHOTO: AGENCE FRANCE-PRESSE  -  285 words
      • Article
        Lock icon Pakistan’s PM-elect takes Taleban’s offer of talks seriously
        282 11 BLOOMBERG ISLAMABAD Pakistan Prime Minister-elect Nawaz Sharif said an offer of peace talks from the country’s Taleban insurgents should be taken seriously to end militant violence that has ravaged the nation for more than a decade. “Every option should be used,” Mr
        BLOOMBERG  -  282 words
      • Article
        Lock icon S. Korean troops ‘abused women too’
        584 12 Osaka mayor’s claim of Viet War-era abuse provokes sharp Seoul response AGENCE FRANCE-PRESSE TOKYO South Korean soldiers were guilty of abusing women in wartime, a Japanese mayor said, days after he provoked a storm by labelling World War II sex slaves a military necessity.
        AGENCE FRANCE-PRESSE  -  584 words
      • Article, Illustration
        Lock icon ABE HAPPY TO LEARN KID’S STUFF
        94 12 It was playtime for Japanese Prime Minister Shinzo Abe at a nursery school in Yokohama in suburban Tokyo yesterday although he was on a serious mission. Yokohama city government has managed to cut the number of children on the waiting list for admission to
        PHOTO: AGENCE FRANCE-PRESSE  -  94 words
      • Article, Illustration
        Lock icon Taiwan fishing crew ‘hid from hail of bullets’
        653 13 Philippine attack was unprovoked, claims son of dead fisherman BLOOMBERG TAIPEI Taiwan fishing boat captain Hung Yu-chi says he was at the helm in quiet seas on the last morning of a six-day trip when he noticed a black dot on the
        BLOOMBERG; PHOTO: BLOOMBERG  -  653 words
      • Article
        Lock icon Boat’s route: Taipei releases satellite record
        230 13 AGENCE FRANCE-PRESSE TAIPEI Taiwan yesterday released a satellite record of the route of a fishing boat fired on by the Philippine coast guard, flatly rejecting Manila’s allegations that the boat intruded into Philippine waters. The killing of crew member Hung Shih-cheng, 65, sparked outrage
        AGENCE FRANCE-PRESSE  -  230 words
      • Article
        Lock icon Aquino details $2.3b military upgrade
        280 13 AGENCE FRANCE-PRESSE MANILA Philippine President Benigno Aquino has announced a US$1.8 billion (S$2.3 billion) military upgrade to help defend his country’s maritime territory against “bullies”, amid a worsening dispute with China. The announcement came on the same day the Philippines filed a protest with China
        AGENCE FRANCE-PRESSE  -  280 words
      • Article
        Lock icon Call to trim Chinese Communist Party’s ‘bloated’ membership
        345 14 HONG KONG A Chinese scholar has suggested downsizing the Chinese Communist Party (CCP), warning that its current “over-bloated” membership of 83 million could cause it to collapse like its counterpart in the Soviet Union did in the early 1990s. “Once a communist
        345 words
      • Article, Illustration
        Lock icon Illegal wildlife products: China ‘not key player’
        595 14  -  Official rebuts report, says checks have been stepped up against such trade By HO AI LI CHINA CORRESPONDENT IN BEIJING hoaili@sph.com.sg CHINA has lashed out at criticism that it is the main culprit behind the global smuggling of wildlife products, especially elephant tusks
        PHOTO: AGENCE FRANCE-PRESSE  -  595 words
      • Article, Illustration
        Lock icon Jusuf Kalla steps up peace drive abroad
        570 15  -  Ex-Indonesian V-P may be honing statesman image ahead of presidential vote By WAHYUDI SOERIAATMADJA INDONESIA CORRESPONDENT IN MAKASSAR (South Sulawesi) wahyudis@sph.com.sg FORMER vice-president Jusuf Kalla, 71, has been stepping up attempts to promote peace and reconciliation beyond Indonesia, in what could be seen
        ST PHOTO: WAHYUDI SOERIAATMADJA  -  570 words
      • Article
        Lock icon 7 Myanmar Muslims get jail over killing of monk
        525 16 Case raises issue of whether Muslim minority can find justice in country ASSOCIATED PRESS MEIKHTILA (Myanmar) A Myanmar court sentenced seven Muslims to prison one of them to a life term in the killing of a Buddhist monk amid deadly sectarian
        ASSOCIATED PRESS  -  525 words
      • Article, Illustration
        Lock icon MCA man in Johor to face discipline panel
        388 16 KUALA LUMPUR A Johor leader of the Malaysian Chinese Association (MCA) has been referred to the party’s disciplinary board and has gone on leave from the party after he broke its decision not to accept a top political appointment in the southern
        PHOTO: THE STAR/ASIA NEWS NETWORK  -  388 words
      • Article
        Lock icon Hydropower meeting slammed
        239 16 AGENCE FRANCE-PRESSE KUCHING Three dozen Malaysian NGOs have denounced the world hydroelectric industry’s decision to hold a conference in Sarawak, where dam projects have uprooted rainforests and displaced thousands of natives. The non-governmental organisations, including the Malaysian chapters of Amnesty International and Transparency International, said in a
        AGENCE FRANCE-PRESSE  -  239 words
      • Article, Illustration
        Lock icon Indian CEO sacked over office affair
        508 17 Second time IT high-flier faces allegation of sexual misconduct MUMBAI/BANGALORE India’s best-known businessman in the information technology sector, has been fired by his United States-based employer for failing to report a relationship with an employee. iGate chief executive Phaneesh Murthy has denied the company’s
        PHOTO: REUTERS  -  508 words
      • ASIA BRIEFS
        • Article
          Lock icon Gunmen let Chinese boat go
          84 17 ASSOCIATED PRESS BEIJING Gunmen wearing North Korean military uniforms beat up the captain of a seized Chinese fishing boat and stole its fuel during two weeks of captivity, but eventually released the boat and crew of 16 yesterday without the 600,000 yuan (S$122,000) ransom they
          ASSOCIATED PRESS  -  84 words
        • Article
          Lock icon S’porean driver jailed in JB
          62 17 JOHOR BARU A Singaporean man was sentenced to seven days’ jail and fined RM5,000 (S$2,000) or be jailed for five months for reckless driving and endangering the public. He had caused a collision involving the Sultan of Johor’s police motorcycle outrider on Monday. Benjamin Lourdes,
          62 words
        • Article
          Lock icon China probes rice mills
          70 17 ASSOCIATED PRESS BEIJING The Chinese authorities are investigating rice mills in southern China following tests that found almost half of the staple grain in Guangzhou was contaminated with toxic metal cadmium, which can seriously damage the kidneys and cause other health problems. The mills in central
          ASSOCIATED PRESS  -  70 words
    • Article, Illustration
      Lock icon Fingerprint scans for foreigners exiting US
      500 20 Senate panel votes for tracking plan at key airports under immigration Bill REUTERS WASHINGTON High-technolo-gy systems for tracking the movements of immigrants and other foreigners when leaving the United States would be installed at major American airports under a plan approved by a congressional
      REUTERS; PHOTO: AGENCE FRANCE-PRESSE  -  500 words
    • Article
      Lock icon Group of Catholic Whistleblowers out to fight abuse
      267 20 NEW YORK TIMES NEW YORK They call themselves Catholic Whistleblowers, a newly formed cadre of priests and nuns who say the Roman Catholic Church is still protecting sexual predators. Although they know they could face repercussions, they have banded together to push
      NEW YORK TIMES  -  267 words
    • Article, Illustration
      Lock icon US racing to boost embassy security as threats mount
      505 21 Measures called for by review panel on Benghazi attack NEW YORK TIMES WASHINGTON By the last few months of this year, the US State Department plans to send dozens of additional diplomatic security agents to high-threat embassies, install millions of dollars
      NEW YORK TIMES; PHOTO: NEW YORK TIMES NEWS SYNDICATE  -  505 words
    • Article
      Lock icon US ‘alarmed’ by attacks against Jews, Muslims
      276 21 AGENCE FRANCE-PRESSE WASHINGTON The United States has denounced what it called a rising tide of anti-Muslim and anti-Jewish sentiment around the world, as it urged all nations to ensure freedom of religion. In a wide-ranging annual report on religious freedom, the State Department
      AGENCE FRANCE-PRESSE  -  276 words
    • Article, Illustration
      Lock icon Deadly tornado kills 24, leaving chaos in its wake
      654 22 / 23 More than 200 injured, rescuers still looking for other survivors REUTERS BLOOMBERG AGENCE FRANCE-PRESSE MOORE (Oklahoma) US rescue teams scoured a shattered suburb for survivors after a tornado tore through the outskirts of Oklahoma City, causing chaos and leaving dozens dead,
      REUTERS; BLOOMBERG; AGENCE FRANCE-PRESSE; PHOTOS: ASSOCIATED PRESS  -  654 words
    • Article
      Lock icon Ordeal’s not over yet as parents wait for children
      422 22 / 23 ASSOCIATED PRESS BLOOMBERG MOORE (Oklahoma) The parents and guardians stood outside a suburban Oklahoma City church, listening intently as someone with a bullhorn called out the names of children who were being dropped off survivors of Monday’s deadly tornado. For many
      ASSOCIATED PRESS; BLOOMBERG  -  422 words
    • Article, Illustration
      Lock icon Residents rush to save family and pets
      480 22 / 23 WASHINGTON Alarms had sounded as the black funnel bore down on the suburb of Moore on Monday, but no one anticipated the massive destruction that left several people dead. A woman with red scrapes on her face identified only as Elizabeth described to
      Graphics adapted from WASHINGTON POST and AFP  -  480 words
    • Article, Illustration
      Lock icon Israel, Syria exchange gunfire at Golan Heights
      555 24 Syrians shot at patrol vehicle that had allegedly crossed ceasefire line REUTERS JERUSALEM Syria said its troops destroyed an Israeli vehicle that crossed into its territory from the Israeli-occupied Golan Heights yesterday and warned that any attempt to violate its sovereignty would meet
      REUTERS; PHOTO: AGENCE FRANCE-PRESSE  -  555 words
    • Article
      Lock icon Tunisian man dies from Sars-like virus
      360 24 ASSOCIATED PRESS RABAT (Morocco) A 66-year-old Tunisian man has died from the new coronavirus following a visit to Saudi Arabia and two of his adult children were infected with it, the Tunisian Health Ministry reported. His children were treated and have since recovered but
      ASSOCIATED PRESS  -  360 words
    • WORLD BRIEFS
      • Article
        Lock icon No let-up in Iraqi violence as 8 die
        114 24 AGENCE FRANCE-PRESSE TIKRIT (Iraq) Five bombings and clashes between soldiers and gunmen killed eight people in Iraq yesterday, the latest in a spate of violence that has cost more than 370 lives so far this month. In Tarmiyah, north of Baghdad, clashes
        AGENCE FRANCE-PRESSE  -  114 words
      • Article
        Lock icon Info leak: State Dept expert charged
        111 24 ASSOCIATED PRESS WASHINGTON The US government is prosecuting a State Department expert on North Korea in a probe that appears to step into uncharted territory by declaring that a journalist is committing a crime in disclosing leaked information. It is the latest case of
        ASSOCIATED PRESS  -  111 words
      • Article
        Lock icon Week-long African trip for Obama
        97 24 AGENCE FRANCE-PRESSE WASHINGTON President Barack Obama will make a week-long trip to Africa next month, the longest journey of his presidency so far to the continent of his father’s family, the White House said on Monday. Mr Obama disappointed many Africans by spending only a
        AGENCE FRANCE-PRESSE  -  97 words
    • MONEY BRIEFS
      • Article
        Lock icon Luxembourg to share tax info
        99 26 AGENCE FRANCE-PRESSE BRUSSELS Luxembourg says it will share information with the US tax authorities about bank accounts held in the country by citizens and residents of the United States. The announcement was made yesterday on the eve of a summit of European Union leaders at
        AGENCE FRANCE-PRESSE  -  99 words
      • Article
        Lock icon Talks to settle trade dispute
        73 26 BLOOMBERG WASHINGTON The Obama administration is engaged in talks with the European Union and China to settle a dispute over trade in solar energy equipment and avoid a conflict among the world’s largest economies, according to people familiar with the discussions. The effort is focused
        BLOOMBERG  -  73 words
    • Article, Illustration
      Lock icon Indonesia inflation ‘may go up to 7%’
      432 26 Hike may occur if govt increases fuel prices, says finance minister BLOOMBERG REUTERS JAKARTA Indonesia could see the inflation rate accelerating to 7 per cent this year if the government raises fuel prices in South-east Asia’s largest economy, says its new Finance Minister
      BLOOMBERG; REUTERS; PHOTO: AGENCE FRANCE-PRESSE  -  432 words
    • Article
      Lock icon Louis Vuitton losing ground to rivals
      229 26 BLOOMBERG PARIS Louis Vuitton is losing ground as the world’s most valuable luxury brand as competitors including Gucci and Prada gain, a new study shows. Louis Vuitton’s brand value fell 12 per cent from a year ago to US$22.7 billion (S$28 billion), Millward Brown
      BLOOMBERG  -  229 words
    • Article
      Lock icon Firms feel heat as Aussie resources boom cools
      571 27 Demand for commodities slowing down, some projects may be shelved REUTERS MELBOURNE A spate of profit warnings from Australian mining services firms suggest the country’s “once-a-century” resources spending boom may have peaked sooner than companies had expected. Australia has been bracing itself
      REUTERS  -  571 words
    • Article, Illustration
      Lock icon JPMorgan’s Dimon retains posts after vote
      292 28 AGENCE FRANCE-PRESSE NEW YORK TIMES REUTERS NEW YORK JPMorgan Chase chief executive officer Jamie Dimon, the most powerful banker in the United States, held onto his title of chairman after the bank’s shareholders defeated a proposal to split the two top jobs. Shareholders also
      AGENCE FRANCE-PRESSE; NEW YORK TIMES; REUTERS  -  292 words
    • Article, Illustration
      Lock icon Apple denies dodging $11b in US taxes
      608 28 Firm welcomes US fiscal law review after Senate says it benefited from loopholes BLOOMBERG REUTERS WASHINGTON Apple denied yesterday using “gimmicks” to dodge taxes and said it welcomes a review of US fiscal laws after a Senate investigation found it used offshore loopholes
      BLOOMBERG; REUTERS; PHOTO: REUTERS  -  608 words
    • Article, Illustration
      Lock icon Tumblr chief quit high school to live his passion
      909 29 He founded the popular blogging site after stints at several outfits NEW YORK TIMES NEW YORK When David Karp was 14, he was clearly a bright teenager. Quiet, somewhat reclusive, bored with his classes at the Bronx High School of Science,
      NEW YORK TIMES; PHOTO: AGENCE FRANCE-PRESSE  -  909 words
    • Article
      Lock icon Wall St firms creating chat program
      264 29 NEW YORK TIMES NEW YORK Nine Wall Street firms have been actively involved in creating an alternative to one of Bloomberg’s most widely used programs, its chat messaging network, people briefed on the effort said. The development predates the controversy over Bloomberg journalists being
      NEW YORK TIMES  -  264 words
  • Page 10 Advertisements
    • Advertisement
      Lock icon Page 10 Advertisements Column 1
      89 10 Indian CEO sacked over sex scandal Tumblr founder a high school dropout A17 B29 VincentChua FounderandOwner ofIFSAcademy INSURANCEANDFINANCIALSERVICESACADEMYPTELTD is offering a seminar to help insurance and financial serviceAdvisors to transit from a sales career to that of a profession. You will learn from a panel of experts who are highly
      89 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 2
      1 10 m
      1 words
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      178 11 citibank Up to 70% Next page for more deals. off your favourite labels. citibank LEANNE KUAH E ady credit citibank HbSS 0012 3HSb T8SS S" 07 10/12 10/lt JOIATRtl TAB VISA PLATINUM I Aiqner Anteprima Etro > I Giuseppe Zanotti Design Groton Rado Rupert Sanderson gold heels courtesy of TANG+Co
      178 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      117 12 ,i t f A.i, V i I, !\i udhM; .'i i i n 1 lU'W rwM: 1 1 if > i-'.i <'.<■' :i v r i 1 m.M§' r 7 i i h 'i; i■ i i'■ 1 1 i; l Mj MILKED AND SEALED FRESH ON ONE FARM i|i
      117 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 2
      242 12 162B rochor road bugis village www.leamingmastery.com Discover The Psychology of 'A' Students for PSLE 'O' Levels LEARNING WHAT REALLY MATTE Learn powerful memory techniques SINCE1985 Discover the 10-Step System to master learning LEARNING Equip your child with the mental processes and tools of top students MASTERY Learn what really matters
      242 words
Page thumbnail Page 13
  • Page 13 Advertisements
    • Advertisement
      Lock icon Page 13 Advertisements Column 1
      265 13 citibank Up to 70% More shopping, on us. off. citibank 1 I lbannbVuah 1 4 MfHin ‘}bHfl:j3*}58jp8S0 j: 23/11 v/IC/ Hb95 0012 3t5b 18SM 7 TAi° 7,T VISA At over 1,000 retail outlets, www.citibank.com.sg K vJ T ANTEPRIMA 4 Mitju r Tun Shoe Company KJ MlcjuShoes www.mltluonllnc.com y Anteprima Up
      265 words
Page thumbnail Page 14
  • Page 14 Advertisements
    • Advertisement
      Lock icon Page 14 Advertisements Column 1
      228 14 starcount presents v* 551 f V m SINGAPORE SOCIAL 2013 WWW.STARCOUNT.COM/TICKETS WHERE WILL YOU BE ON THE LONG WEEKEND? ROCKING OUT WITH CEELO GREEN, PSY, CARLY RAE JEPSEN, BLUSH on on fh 24th May) ROCK LEGENDS AEROSMITH? (SAT 25TH MAY) To get you excited about the weekend we have created
      228 words
Page thumbnail Page 15
  • Page 15 Advertisements
    • Advertisement
      Lock icon Page 15 Advertisements Column 1
      51 15 Read it in tomorrow WHY REJECTION IS REPULSIVE The reply is in the genes 1 before you can catch Sky Blu of LFMAO! more day SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand
      51 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 2
      545 15 Standard Chartered Here for good V > C-J r 1 IV JU 1 L f auspicious ways to bring home J Min 'A -r S; 1/ c/ collectibles m r m r* r j ji t a* Wfvff a a* PREFERRED Banking It’s good when your savings bring you more
      545 words
Page thumbnail Page 16
  • Page 16 Advertisements
    • Advertisement
      Lock icon Page 16 Advertisements Column 1
      77 16 3 /axnasia ©apprenticeasia v I u Vs* 3 t J MMbi i I M 1 V 1 r Sf r°^ 3 *r > X V. i y J ”3*7 Mi (Si wm XI WORLD PREMIERE, TONIGHT AT 9.05PM AXN Ch 511 and AXN HD Ch 559 are available on StarHub
      77 words
Page thumbnail Page 17
  • Page 17 Advertisements
    • Advertisement
      Lock icon Page 17 Advertisements Column 1
      54 17 1 before you can catch Sky Blu of LFMAO! more day SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column computer problems? Serv&gSjmmm Mjetworking ConfigurafiSM For a FREE consultation, Wesley Cheng +65 *****096
      54 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 2
      422 17 YOUR EVERYDAY GREAT VALUE STORE BECAUSE SMART SHOPPERS DESERVE MORE SMART DEALS CARDMEMBERS’ EXCLUSIVE PREVIEW 22 27 May 2013 90°/» OFF REGULAR-PRICED ITEMS WITH EXISTING UP TO 70% OFF* terms conditions apply. JOHN LITTLE $25-$29 Intero Homme/Femme 500TC 100% Cotton Sateen Reactive Jet Print Fitted Sheet Set Single King U.P.
      422 words
Page thumbnail Page 18 / 19
  • Page 18 / 19 Advertisements
    • Advertisement
      Lock icon Page 18 / 19 Advertisements Column 1
      629 18 / 19 m V x t' Ac I' A i *V-( i rj-; r m\*ri i rnrmi chiTCDDotr^ u j ?3wVr%' DBS Marina Regatta Singapore's Biggest Water Sports Festival |Lf atyj* 3 JB* Cosplay Festival and Parade More than 100 cosplayers added colour and vibrancy to the DBS Marina Regatta with their
      629 words
Page thumbnail Page 20
  • Page 20 Advertisements
    • Advertisement
      Lock icon Page 20 Advertisements Column 1
      556 20 ntuc )luj! u plus! 1 ,0 Discover the power of u pi •m ■mu ntuc National Trades Union Congress In our Family 6,000 Union Leaders Representing more than 700,000 NTUC Members everyone counts Appreciating every labour of love with more privileges for NTUC Members at PowerOfU.sg > KFC $1 OFF
      556 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 2
      17 20 CLICK IT Just tap on “My Tip-Of” on www.straitstimes.com if there are things you want to share!
      17 words
Page thumbnail Page 21
  • Page 21 Advertisements
    • Advertisement
      Lock icon Page 21 Advertisements Column 1
      205 21 BRING YOUR INTERNET CONNECTION UP TO SPEED WITH ULTRA-FAST Ml BUSINESS FIBRE BROADBAND. V 1 < /A 'Cl 0 <?c/ </ »v Fibre BizPac Dynamic 100Mbps $18"Z25/mth Free ASUS VivoBook R303CA (worth $1,398) Free WiFi Router Choose 2 of the following services for free: 1. SecureStorage 35GB 2. DesktopProtect 5
      205 words
Page thumbnail Page 22 / 23
  • Page 22 / 23 Advertisements
    • Advertisement
      Lock icon Page 22 / 23 Advertisements Column 1
      225 22 / 23 NO SURGERY Saturday1June2013 A STAR ALLIANCE MEMBER €0THAI Magnificent Thailand, Marvellous Fares. Business Class All-in Fare from Bangkok $788 Economy Class All-in Fare from Bangkok $288 Chiang Mai $388 Chiang Rai $388 Ticketing from now to 30 June 2013 Departure from now to 30 September 2013 Call your travel agent
      225 words
    • Advertisement
      Lock icon Page 22 / 23 Advertisements Column 2
      110 22 / 23 Singapore Largest Safe Stockist 50% Discount HOT SALE this week. ST17 $78 $398 $188 $39 GM23 H17 x W23 x D17(cm) H23 x W44x D39(cm) Present this Coupon Toa Payoh Kaki Bukit to enjoy the offer Night Deposit Safe Home Safe Personal Safe $318 Cabinet Safe $480 $158 B9055 125
      110 words
    • Advertisement
      Lock icon Page 22 / 23 Advertisements Column 3
      102 22 / 23 INVEST IN BOOMING DUBAI Own an exclusive designer apartment with everlasting sea views in Dubai Marina, interior design by Fendi Casa FROM SGD 775,000 FENDI CASA I a it mOwn a Hollywood inspired luxury hotel apartment by Paramount in the Burj Khalifa area, Dubai FROM SGD 674,000 •m WtW 1
      102 words
Page thumbnail Page 24
  • Page 24 Advertisements
    • Advertisement
      Lock icon Page 24 Advertisements Column 1
      773 24 BrainFit Studio no' 1 loo 56O* 0ff S< 20 Ies^°" s .$200* ofF 4 fie Part Of Our BrainFit Revolution Brainy Open House 1 June 2013 (Sat), 9am -12 noon 193 Thomson Road, Goldhill Centre Pre-School years are a critical period where important learning foundations are laid. There is more
      773 words
Page thumbnail Page 25
  • Page 25 Advertisements
    • Advertisement
      Lock icon Page 25 Advertisements Column 1
      764 25 KEYSER TECHNOLOGIES Celebrating Another Milestone In Our Journey To Excellence KEYSER TECHNOLOGIES PTE LTD, a locally-owned company is honoured to be the World’s First Manufacturer of Cryogenic Bellow Expansion Joints (outside Japan) to be accredited by NIPPON KAIJI KYOKAI (ClassNK Japan) The Team At The Helm Of KEYSER “Quality and
      764 words
Page thumbnail Page 26
  • Page 26 Advertisements
    • Advertisement
      Lock icon Page 26 Advertisements Column 1
      1105 26 SingExpress Cr Travel 1 Safe2Travel Singapore Malaysia Hong Kong China Macau Australia PRICE mjA HOTEL GUARANTEE V# GUARANTEE www.singexpress.com.sg FLIGHT GUARANTEE QUALITY f GOURMET info@singexpress.com.sg LET'S GO! ASIA BARGAIN BREAKS INDONESIA 2D BINTAN iiD NIRWANA RESORT fr$ IIO return ferry (SIN-BINTAN-SIN) 1 night at Nirwana Resort with breakfast return terminal
      1,105 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 2
      43 26 MyExecutive cold Study pours common water on remedies Social media isn’t a free-for-all space, says Joy Fang eczema NEWS A6 自多正 A20 MyPaper ublic-securityb MONDAY MAY 20 2013 MCI (P) 116/05/2013 mypaper.sg ENSURINGORDER Samsung to address Galaxy S4’s storage issue ON
      43 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 3
      56 26 BEATS CLASSIFIED BUY IT-SELL IT-FIND IT Find great programmes to keep kids active and smart in Nurturing the Young. PAGES C4 C5 Here's a device that will bring you 'bacteria-free air'. CLASS 134 Three-level spa in Arab Street for takeover. CLASS 209 Find these and other products and services in
      56 words
Page thumbnail Page 27
  • Page 27 Advertisements
    • Advertisement
      Lock icon Page 27 Advertisements Column 1
      9 27 S I N G A P O R E
      9 words
    • Advertisement
      Lock icon Page 27 Advertisements Column 2
      276 27 Enjoy cash rebate* at Guardian Get healthy discounts with Maybank Family Friends Platinum MasterCard From 22 to 28 May 2013, enjoy an additional 5% cash rebate on top of the usual 5% cash rebate on your purchases at Guardian stores island-wide. Your Family Friends Platinum MasterCard also entitles you to
      276 words
Page thumbnail Page 28
  • Page 28 Advertisements
    • Advertisement
      Lock icon Page 28 Advertisements Column 1
      276 28 ii Heuristics Workshops POWER UP FOR A* IN PSLE MATHS SCIENCE Conducted in small trainer to pupil ratio, your child will receive focused attention. He/She will quickly learn heuristics techniques, and be able to apply them right away. The authors of the Mastering Heuristics Series, Sunny Tan, Cedric Chai and
      276 words
    • Advertisement
      Lock icon Page 28 Advertisements Column 2
      150 28 Every moment is a refreshing experience. Enjoy the luxury of space and a day-bed at a very reasonable rate. PREMIER www.equatorial.com Singapore Reservation Office Tel +65 6333 5788 equatorial@link.com.my Melaka Tel: 606 282 8333 ‘OV’A’ Level June Revision Program TRANSFORM Your Results From Fail TO A Math. Chemistry. Physics. Biology.
      150 words
    • Advertisement
      Lock icon Page 28 Advertisements Column 3
      73 28 REVERSE HAIR LOSS WITH BOSLEY! Take the next step and see what Bosley can do for you. Schedule your FREE private consultation today! Hair Transplantation Eyebrow Restoration Oral Medication Laser Therapy REQUEST A FREE GUIDEBOOK AND DVD TODAY! BOSLEY HAIR RESTORATION CLINIC Consultations are now available(walk-ins welcome) +65 6235 9658
      73 words
Page thumbnail Page 29
  • Page 29 Advertisements
    • Advertisement
      Lock icon Page 29 Advertisements Column 1
      399 29 Nature's Farm" I Up to Specials 50 43 OFF Manuka Honey Hot OFF Buysl Health Sports Su Pplements 010 Receive a FREE Allure Collagen Drink IS (worth$11.15) with any purchase! Electronics SME Outreach TRANSFORMATION FOR PROGRESSIVE GROWTHjfL/ Industry experts will share on various funding schemes toh assist companies in boosting
      399 words
Page thumbnail Page 30
  • OPINION
    • Article
      Lock icon China seeks larger diplomatic footprint
      438 30 CHINA’S bid to facilitate the Israel-Pales-tine negotiations is being regarded in some quarters as a quixotic quest, as even the United States has found itself exhausted after fruitless mediation over half a century. Contrarians would argue that a fresh superpower with no baggage in Semitic
      438 words
    • Article, Illustration
      Lock icon Is Australia ready for Asia’s new strategic realities?
      987 30  -  BY INVITATION Australia’s defence policy ignores the strategic implications of China’s rise. By HUGH WHITE FOR THE STRAITS TIMES stopinion@sph.com.sg The writer is professor of strategic studies at the Strategic and Defence Studies Centre, Australian National University. By Invitation features expert views
      987 words
    • Article
      Lock icon Publishing prosecutorial guidelines: promise, risk and reality
      1662 32  -  Calls to publish guidelines on prosecutorial decisions are unfounded, as such decisions are already subject to scrutiny in the court, while publication of guidelines carries risks. By AEDIT ABDULLAH FOR THE STRAITS TIMES stopinion@sph.com.sg The writer is Chief Prosecutor in the Attorney-General’s Chambers.
      1,662 words
    • Article, Illustration
      Lock icon Quid pro quo diplomacy in US-Myanmar relations
      911 32  -  By NEHGINPAO KIPGEN FOR THE STRAITS TIMES stopinion@sph.com.sg The writer is general secretary of the US-based Kuki International Forum. WHATtriggersformer foes to become friends and then listen to each other on their mutual interests is one puzzle that political scientists ask themselves. This
      PHOTO: REUTERS  -  911 words
    • Article, Illustration
      Lock icon Britain’s EU dilemma – Should it stay or go?
      989 33  - Britain’s EU dilemma Should it stay or go? By GIDEON RACHMAN FINANCIAL TIMES TWENTY years ago, I was an anti-European. Today, I am a pro-Euro-pean. The strange thing is that my views have not changed. I have always thought that Britain should stay out of the euro but inside the
      FINANCIAL TIMES; PHOTO: REUTERS  -  989 words
    • FORUM
      • Article
        Lock icon SMA explains aim of giving feedback
        193 34  -  Tammy Chan (Dr) Honorary Secretary Singapore Medical Association WE WISH to put in perspective our feedback to the Singapore Medical Council (“Medical council urged to be ‘more transparent’ last Friday). Our suggestions were sent to the SMC Review Committee on April 5 upon its
        193 words
      • Article
        Lock icon Social cohesion not left to market forces
        438 34  -  Lim Bee Khim (Ms) Director Corporate Communications Ministry of Finance MR PAUL Chan Poh Hoi was rightly concerned about rising inequality as well as the vulnerability of white-collar workers to the forces of globalisation and technology (“Rising inequality may not lift all boats”;
        438 words
      • Article
        Lock icon Timely warning of online dating dangers
        260 34  -  Muhammad Dzul Azhan Haji Sahban I AGREE with Miss Annabel Tanya Leo Arthur (“Why even more will turn to online dating”; Forum Online, Monday). Several of my friends found their spouses through online dating websites. The young may find it awkward to befriend someone
        260 words
      • Article
        Lock icon FORUM ONLINE
        66 34 More letters on www.straitstimes.com 1. MR PATRICK LOH: COE quota insufficient. 2. MR QUEK CHIN TIONG: Alumni priority allows schools to grow endowment funds. 3. MS TAN MING HUI: Priority for children of alumni should stay. 4. MS ADA CHAN: Buses not designed for open strollers. 5. MRS
        66 words
      • MY POINT
        • Article
          Lock icon Penalties for illegal hawkers
          169 34  -  Tai Ji Choong Director, Environmental Health Department National Environment Agency THE National Environment Agency takes a serious view of illegal hawking because of public health and food safety implications (“Help illegal curry puff sellers” by Mr Fun Chee Heng; May 11). We conduct checks on street
          169 words
        • Article
          Lock icon Tray-return windows more effective
          159 34  -  Jonathan Toh Joo Khai I WELCOME the tray return initiative by the National Environment Agency (“17 major operators get on board tray-return drive”; Monday). However, in order for it to succeed, there needs to be a rethink of the layout of foodcourts and hawker centres. Instead
          159 words
      • Article
        Lock icon Set ground rules for alumni groups
        273 35  -  PRIMARY 1 REGISTRATION Estella Young (Ms) THE debate over alumni priority for primary school admission overlooks the issue of whether the individual alumni associations reinforce the rich-poor divide by erecting high financial barriers to entry. While the alumni associations of reputable schools like CHIJ
        273 words
      • Article
        Lock icon School ties that bind
        307 35  -  Chua So En (Ms) I DISAGREE that children of alumni should not be given priority in the Primary 1 registration process (“Do away with priority for children of alumni” by Ms Jasmine Chang; May 11). For new Singaporeans or those whose primary schools no longer exist,
        307 words
      • Article
        Lock icon WRITE IN
        58 35 Letters should be meant for exclusive publication in The Straits Times. They should be no longer than 400 words and must include the writer’s full name, address and phone numbers. The Forum editor reserves the right to edit the letters. Please e-mail your letter to stforum@sph.com.sg. Readers can
        58 words
      • YOUTH FORUM
        • Article
          Lock icon National Education key to racial harmony
          174 35  -  Sandra Tan Zi Ning 18, polytechnic student WE HAVE come a long way since the 1964 racial riots. Recently, MP Hri Kumar Nair recounted in Parliament his backpacking trip to Bangkok in 1991, and how a street vendor there, noticing him walking together with
          174 words
        • Article
          Lock icon The magic of a smile
          113 35  -  Hillary Teo 18, polytechnic student I TAKE an interest in observing human behaviour, and it has dawned on me that people here are becoming more hostile. Technological advances have led to people being wrapped in their own “bubble”. On the train, people are engrossed in
          113 words
  • Page 30 Advertisements
Page thumbnail Page 31
  • Page 31 Advertisements
    • Advertisement
      Lock icon Page 31 Advertisements Column 1
      1795 31 If you think SPH is just a newspaper company, DANCER TREADS LIGHTLY THROUGH LIFE LAW LESSONS FOR SECONDARY STUDENTS TOP OF THE NEWS A2-3 NEW COLUMN PEOPLE TO WATCH ROBOGALS TO BRIDGE TECH GENDER GAP LIFE! C6 SINCE 184 5 M O N D A Y ,J U L Y
      1,795 words
Page thumbnail Page 32
Page thumbnail Page 33
  • Page 33 Advertisements
    • Advertisement
      Lock icon Page 33 Advertisements Column 1
      69 33 Think SPH Think Experiences Come and be part of our mega exhibitions and events like COMEX and IT Show, Asian Masters and Beerfest Asia by our Sphere Exhibits and its subsidiaries. We also create memorable experiences with our signature events such as the SPH Gift of Music concert series, ChildAid
      69 words
Page thumbnail Page 34
  • Page 34 Advertisements
    • Advertisement
      Lock icon Page 34 Advertisements Column 1
      98 34 Have a story? Let us know text 8282-3343 E-MAIL stnewsdesk@sph.com.sg CALL 1800-*****28 CLICK “My Tip-Of” on www.straitstimes.com sp'i SINGAPORE PRESS HOLDINGS Catch up on the Latest News with AsiaOne smartphone app -j, Australia adds most iobs in pi almost 13 veats S40 million to encoutage| iljja tamilv environment MALAYSIA Pav
      98 words
    • Advertisement
      Lock icon Page 34 Advertisements Column 2
      35 34 iaat> <3n W Crocodile BAZAAR RTS 23 MAY 2013 UP TO 0 OFF EXCLUSIVELY AT CROCODILE HOUSE, 3 UBI AVE 3 #01-00 T: 6439 3135 MONDAY TO FRIDAY, 9AM 7PM SATURDAY, SUNDAY PH, 10AM 6PM
      35 words
Page thumbnail Page 35
  • Page 35 Advertisements
    • Advertisement
      Lock icon Page 35 Advertisements Column 1
      117 35 SHINAGAWA LASIK Eye Centre #vtea I I-1 ;iiu, ■<A tv- r 'v th 1 U. r > 'tl* < J 1 .',::i- 4 > v jr, \5\':''. r‘-.''. t t'! 1 '’v <» c > $r < i < r *j»a v- v’ o,V' ,Cc C -> w»: i. ID
      117 words
    • Advertisement
      Lock icon Page 35 Advertisements Column 2
      223 35 CALLING ALL YOUNG READERS: Youth Forum is a weekly column showcasing the views of our younger readers. If you are below 21 and want to air your opinion on any issue, send us your letter via e-mail to stforum@sph.com.sg with the header “Youth Forum”. Do include your age and contact
      223 words
  • Page 35 Miscellaneous
    • Miscellaneous
      Lock icon Page 35 Miscellaneous Column 1
      201 35 PUNCHLINES NEWS ITEM Govt to ramp up workplace safety efforts One group are foreign workers, whose different languages and work practices at home increase the risk of an accident here. At stake are their families back home whom they are supporting, Mr Lee told 300 employers and industry leaders at
      201 words
Page thumbnail Page 36
  • Page 36 Advertisements
    • Advertisement
      Lock icon Page 36 Advertisements Column 1
      344 36 V 7 4tJti i m NOW TO SUN9JUN 2013 TAKASHIMAYA SQU E, B2 r SQUARE B ANNIVERSARY i i Bl 1 laSSM iirisi f as ’r- A9 N Y 7*7** mK ■'lr*»*«' *j.'—., j ..I ■,.i --o-q > (Umi^ <-**X2*4-: a* 1 I w' f W' I 6 ir 1
      344 words
Page thumbnail Page 1
  • HOME
    • Article, Illustration
      Lock icon Take a virtual peek inside these places
      616 1  -  Google tech lets customers take tours from the comfort of home By JANICE TAI jantai@sph.com.sg SCOUTING for the best table in a restaurant is now just a click of a mouse away. Similarly, car enthusiasts can check out the latest models at a
      PHOTOS: SMAP AGENCY  -  616 words
    • Article, Illustration
      Lock icon Church and firm extremely close: DPP
      671 2  -  Xtron director admits that church made many key decisions for firm CITY HARVEST TRIAL By BRYNA SINGH brynasim@sph.com.sg THE relationship between City Harvest Church (CHC) and an external company, Xtron Productions, is an extremely close one, prosecutors sought to establish on the fourth day
      ST PHOTO: SEAH KWANG PENG  -  671 words
    • Article
      Lock icon 2 guarantees to cover Crossover Project’s losses
      327 2  -  By TESSA WONG twong@sph.com.sg CITY Harvest Church had two guarantees to cover any potential losses from its Crossover Project, it emerged in court yesterday. The first was taken out by Indonesian businessman and church member Wahju Hanafi, who promised to bear any losses
      327 words
    • Article
      Lock icon Search for bigger church site
      300 2  -  By MELODY ZACCHEUS, BRYNA SINGH melodyz@sph.com.sg brynasim@sph.com.sg FOR more than two decades, City Harvest Church has been searching for a building big enough to hold its burgeoning congregation. The third witness to take the stand, property developer Koh Siow Ngea and director of Xtron Productions,
      300 words
    • Article, Illustration
      Lock icon S’pore top convention city in Asia for 11th year
      375 4  -  It is only Asian city in global top 10, record 150 ICCA events held last year By RACHEL CHANG rchang@sph.com.sg SINGAPORE is Asia’s top convention city for the 11th year running, according to a global ranking that tracks the most popular
      PHOTO: DESMOND LUI FOR THE STRAITS TIMES  -  375 words
    • Article, Illustration
      Lock icon AVA explains monkey trapping video
      438 4  -  By JANICE TAI jantai@sph.com.sg THE Agri-Food and Veterinary Authority (AVA) has responded to a public outcry over a YouTube video showing one of its contractors herding a wild monkey into a cage. Titled “How Singapore handles its wild macaques”, the video last night garnered more
      ST FILE PHOTO  -  438 words
    • Article, Illustration
      Lock icon Travel firms join anti-dengue fight as June nears
      288 5  -  By FARAH MOHD ISMAIL ifarah@sph.com.sg WITH the June school holiday approaching, some travel agencies have been roped in to help fight dengue. They will hand customers a checklist on how to stop the breeding of mosquitoes while they are on vacation, as
      ST PHOTO: AZIZ HUSSIN  -  288 words
    • Article
      Lock icon Law course dropped over lack of students
      572 5  -  NYU@NUS course discontinued from next year as it’s ‘not self-financing’ By SANDRA DAVIE SENIOR EDUCATION CORRESPONDENT sandra@sph.com.sg A LAW programme run by New York University and the National University of Singapore is being scrapped due to the poor take-up rate. The schools said
      572 words
    • Article, Illustration
      Lock icon GET COSY WITH MARINE CREATURES
      90 6 From today, visitors to the Marine Life Park at Resorts World Sentosa can get up close with the animals, like this leopard ray (above), through a series of Ultimate Marine Encounters. The first of these to debut is the Open Ocean Dive, which allows certified
      ST PHOTO: JAMIE KOH  -  90 words
    • Article, Illustration
      Lock icon Extra support for victims of crime
      390 6  -  Volunteers will be trained to care for those who are affected by rape or murder By JALELAH ABU BAKER jalmsab@sph.com.sg VICTIMS of rape and relatives of murder victims will soon be able to call on additional support as they recover from their ordeals. A
      390 words
    • Article
      Lock icon Plug 3G gap at home or in office
      459 7  -  Device allows M1 mobile customers to use phone in places with weak signals By IRENE THAM TECHNOLOGY CORRESPONDENT itham@sph.com.sg TELCO M1 will roll out a device by September that will allow its mobile phone users to make calls, send SMS and access
      459 words
    • Article, Illustration
      Lock icon NTU helps to develop cancer-fighting agent
      431 7  -  By CHENG JINGJIE jingjie@sph.com.sg SCIENTISTS from Nanyang Technological University (NTU) have helped to develop a molecular structure which can kill various tumour cells without causing much harm to healthy cells. Along with a team from Lund University in Sweden, they based the complex on
      PHOTO: NANYANG TECHNOLOGICAL UNIVERSITY  -  431 words
    • Innovative practices overseas
      • Article
        Lock icon Rewarding volunteers with “time credits”
        84 8 Non-profit organisations can give people rewards based on how much time they spend helping one another. In Japan’s Hureai Kippu scheme which was created in the 1990s and is translated literally as “caring relationship tickets” those who help the elderly earn “time credits”. They can
        84 words
      • Article
        Lock icon Giving the elderly a “village” to lean on
        69 8 Pioneered by Beacon Hill Village in the United States in 2001, this approach involves recruiting elderly residents and other volunteers who live in an existing community to help one another with basic services such as transportation, household tasks and health care. Although
        69 words
      • Article
        Lock icon Having one team to offer all-inclusive care
        110 8 PRISCILLA GOY participants in the Programme of All-Inclusive Care for the Elderly in the US attend an adult day health centre, where they receive services that are provided by a multi-disciplinary care team. These services include speciality medical care, therapy, transportation and help
        PRISCILLA GOY  -  110 words
    • Article, Illustration
      Lock icon Consider elderly patients’ social needs too, docs urged
      513 8  -  Study says a holistic view of care should be adopted By PRISCILLA GOY goyshiyi@sph.com.sg DOCTORS treating the elderly need to be more aware of their patients’ social and psychological needs, a new report has found. They should take a holistic view instead
      ST FILE PHOTO  -  513 words
    • Article
      Lock icon SIA inks first code-share deal with Chinese airline
      474 9  -  Tie-up with Shenzhen Airlines a positive though long overdue move, say analysts By KARAMJIT KAUR AVIATION CORRESPONDENT karam@sph.com.sg SINGAPORE Airlines has signed its first code-share deal with a Chinese carrier. The tie-up between SIA/SilkAir and Shenzhen Airlines means the companies can sell
      474 words
    • Article
      Lock icon Ordinary Account interest rate stays at 2.5%
      199 9 ALL Central Provident Fund (CPF) members will continue to get a 2.5 per cent interest rate on their Ordinary Account (OA) savings from July 1 to Sept 30 this year. The computed CPF interest rate, derived from interest rates of major local banks
      199 words
    • Article
      Lock icon Numbers add up for Sinda tuition project
      312 9  -  By KASH CHEONG kashc@sph.com.sg WHEN 11-year-old West Grove Primary School pupil Yeasha Ravikumar started attending mathematics tuition last year, she was not interested in the subject and had little confidence in it. Now she turns up for every class and has developed a
      312 words
    • Article
      Lock icon Court orders return of boy, 3, to German dad
      622 10  -  S’pore mum fails to show son will be harmed if returned to Germany: Judge By K.C. VIJAYAN SENIOR LAW CORRESPONDENT vijayan@sph.com.sg THE High Court has ordered a Singaporean woman to return her three-year-old son to his father, who has sought to
      622 words
    • Article
      Lock icon Man who forged timesheets gets six months’ jail
      266 10  -  By KHUSHWANT SINGH khush@sph.com.sg A CUSTOMER service officer who was sacked by StarHub for tardiness racked up $18,800 in wages by continuing to submit timesheets to his recruitment agency. Muhammed Syahmi, 23, was jailed for six months yesterday after admitting to forging
      266 words
    • Article
      Lock icon Lorry driver in head-on crash jailed 8 weeks
      321 11  -  He also gets five-year driving ban for causing man’s death, injuring 14 By ELENA CHONG elena@sph.com.sg A LORRY driver was yesterday jailed for eight weeks and banned from driving for five years after causing a head-on crash with another truck that left
      321 words
    • Article, Illustration
      Lock icon Man gets 2½ years for stealing cough syrup
      308 11  -  By KHUSHWANT SINGH khush@sph.com.sg A MAN who stole $300 worth of cough syrup from a clinic which had refused to sell it to him was jailed for 21/2years yesterday. Police officers spotted Lim Chee Wei, 32, climbing through the rear toilet window
      PHOTO: SINGAPORE POLICE FORCE  -  308 words
    • Article
      Lock icon Man charged with shooting upskirt videos of women
      239 11  -  ELENA CHONG A MAN was charged in court yesterday for surreptitiously video-taping women’s thighs and underwear over a two-year period. Kew Guozhi, 31, is alleged to have used a camera pen to shoot the upskirt videos between 2009 and 2010. He faces
      239 words
  • Page 1 Advertisements
Page thumbnail Page 2
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      529 3 LUzi o o c n Q i ivy i i n PRICE-SLASHED lRDMEMBERS’ gss S.ONEDAWONIS STARTS CO 3 CO LU TOMOR UP TO Earn 5% Metro$ Reb when you charge to y e LJ C etro-UOB Platinum Card #UOB B84I in nr LE ANN WONG ffijj METRO Platinum OR ;ktCHAS
      529 words
Page thumbnail Page 4
  • Page 4 Advertisements
    • Advertisement
      Lock icon Page 4 Advertisements Column 1
      162 4 SCHOOL OF SCIENCE AND TECHNOLOGY. SINGAPORE nuf child We nkaj- Cf Lakes h achieve Success in Ihe -?/Sf Cenlury e e? tjf See the Possibilities Seek the Solutions ransform the Future 'M The Way 1 turvtf re^ wilt /4e school's leaching laelhods help tnu child, achieve academic excellence Unleash your
      162 words
    • Advertisement
      Lock icon Page 4 Advertisements Column 2
      308 4 SHELLEY PIANO SELLING FINE PIANOS FOR PAST 3 8 YEARS. Recommendation from piano teachers are welcome. 6255 2222 www.shelleypiano.com Yamaha Kawai German Pianos $699, $1500, $3000, $3800 Repair, Tuning, Moving WANTED) USED PIANO .GUARANTEE ■£80ffi$l'G)‘G)'O bhe^ber: DAYS from 24/25/26 May 2013 Friday to Sunday 10am 7pm Blk 301 3 Bedok
      308 words
Page thumbnail Page 5
  • Page 5 Advertisements
    • Advertisement
      Lock icon Page 5 Advertisements Column 1
      258 5 Come onboard www.playtime.com.my/little-big-club for a day of great interactive fun and special surprises. ■T\ 2 From 22 26 May, identify the 5 characters appearing in The Straits Times to win great prizes in our "Spot Win" Contest. Your answer must be in chronological sequence. SMS your entry in this format
      258 words
Page thumbnail Page 6
  • Page 6 Advertisements
    • Advertisement
      Lock icon Page 6 Advertisements Column 1
      413 6 A GOOD DEAL NOTONLY SAVES YOU MONEY. IT SAVES YOU TIME. THE TANGS G y////////////, SINGAPORE LE oooooooooo oooooooooo 12 0/ /o REBATE' TODAY Exclusively for TANGS Cardmembers and Citibank Credit Debit* Cardmembers A Closed-door Preview 22 May (Wed) Open Door 23 May (Thu) TANGS Orchard 10.30am 9.30pm TANGS VivoCity
      413 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 2
      70 6 1 moreday before you can catch Carly Rae Jepsen! SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column Read it in tomorrow MORE PEOPLE HERE DEVELOPING LYMPHOMA But more are surviving the cancer
      70 words
Page thumbnail Page 7
  • Page 7 Advertisements
    • Advertisement
      Lock icon Page 7 Advertisements Column 1
      254 7 Nanyang Confucian Association, Asian Civilisations Museum Co-organisers Mandarin Lecture 7 Is Confucianism a Religion? Confucianism is commonly understood as a philosophy or a system of thought Yet over a century ago t was advocated as a religion in China and defended as such. The crux of the problem lies in
      254 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 2
      480 7 -AN SIDGAPORE AIRLIDES KrisFlyer A STAR ALLIANCE MEMBER I J 3153 i B3 m a* MILES MAKE A JOURNEY POSSIBLE. THE EXTRAS MAKE IT UNFORGETTABLE. Introducing the NEW American Express® Singapore Airlines KrisFlyer Ascend Credit Card. Discover unforgettable journeys, beginning with double 1 KrisFlyer miles on selected purchases at singaporeair.com,
      480 words
Page thumbnail Page 8
  • Page 8 Advertisements
    • Advertisement
      Lock icon Page 8 Advertisements Column 1
      222 8 THE BEST MATTRESSES PAYFOR I THEMSELVES NIGHT AFTER NIGHT. THE TANGS GREAT SINGAPORE LE oooooooooo oooooooooo 12 0/ /o REBATE' TODAY Exclusively for TANGS Cardmembers and Citibank Credit Debit* Cardmembers A Closed-door Preview 22 May (Wed) Open Door 23 May (Thu) TANGS Orchard 10.30am 9.30pm TANGS VivoCity 10am 10pm FREE
      222 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 2
      69 8 n I CLASSIFIED W 2043 (in event ftor active ayem aged 50 ami afiave 27 28 July 10am 8pm Suntec Singapore Exhibition Hall 404 Looking for a platform to reach out to the right crowd for your products services? y y/ m m a Attracting more than 50,000 visitors! For
      69 words
Page thumbnail Page 9
  • Page 9 Advertisements
    • Advertisement
      Lock icon Page 9 Advertisements Column 1
      12 9 I 31 G >sit# y U a A .V POH H ENG
      12 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 2
      175 9 180’s, Usual: $107.95 90’s, Usual: $24.95 Also available in 180’s Buy 1 Get 1 FREE Conditions apply 6281 5688 or 6757 4403 www.gnc.com.sg Ui‘ j SINGAPORE I WSJ WORKFORCE SKILLS f QUALIFICATIONS Upgrade Your Bartending Skills Attend our WSQ Bartender Training Programme Receive both International WSQ Certification! Modules: Prepare Serve
      175 words
Page thumbnail Page 10
  • Page 10 Advertisements
    • Advertisement
      Lock icon Page 10 Advertisements Column 1
      379 10 TANGS’ GREAT SINGAPORE SALE oooooooooo I oooooooooo 79% x REBATE* TODAY Exclusively for TANGS Cardmembers and Citibank Credit Debit* Cardmembers “Closed-door Preview 22 May (Wed) Open Door 23 May (Thu) TANGS Orchard 10.30am 9.30pm TANGS VivoCity 10am 10pm FREE $50 TANGS Home Voucher with $500 mattress purchase S3 Postur epedic
      379 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 2
      87 10 1 moreday before you can catch Jeremy Piven! SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column Why Hariss Harun is out to impress thenewpaper S’PORE SELECTION v ATLETICO MADRID thenewpaper Have a
      87 words
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      14 11 CALL US Give The Straits Times a buzz if you spot something newsworthy 1800-*****28
      14 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 2
      265 11 MAHS*****94 90’s, Usual: $17.50 Also available in 1000mg 240’s, Usual: $219.50 Buy2for the price of1 50%off Conditions apply 6281 5688 or 6757 4403 www.gnc.com.sg Find the most comprehensive range of products and services in CATS Classified in The Straits Times. WAT-3 W GTC RELATIONSHIPS TAKE TIME TO BUILD. ITS TIME
      265 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      307 12 Subscribe to SPH Directly Stay Connected Enjoy your news on PRINT, ONLINE, SMARTPHONES, or TABLETS when you subscribe direct. Same Service The same newspaper vendor will continue to serve you. No Surprises No untimely visits for payment collection. SPH Rewards Direct subscribers enjoy exciting rewards at sphrewards.com.sg •’"N |THE STRAITS
      307 words
Page thumbnail Page 13
  • MONEY
    • Article, Illustration
      Lock icon Exchange rate policy still relevant for S’pore: MAS chief
      603 13  -  Not allowing Sing$ to appreciate would have worsened inflation By AARON LOW By ASSISTANT MONEY EDITOR aaronl@sph.com.sg EVEN as the exchange rate policy remains Singapore’s most potent tool against inflation, the Government is relying more on special policy tools to nip
      PHOTO: BLOOMBERG; ST FILE PHOTO  -  603 words
    • Article, Illustration
      Lock icon Reits look like good bets to yield-hungry investors
      531 14  -  They continue to post gains while earnings in other sectors disappoint By GOH ENG YEOW SENIOR CORRESPONDENT engyeow@sph.com.sg SINGAPORE real estate investment trusts (Reits) are among the hottest assets in town to own. All the 23 Reits listed on the Singapore Exchange
      Source: BLOOMBERG  -  531 words
    • Article, Illustration
      Lock icon Asia-Pacific Reits gain 18% in first four months of year
      403 14  -  By FIONA CHAN SENIOR ECONOMICS CORRESPONDENT fiochan@sph.com.sg PROPERTY trusts across the Asia-Pacific have performed impressively in recent months, led by a surge in the value of Japanese real estate investment trusts (Reits). Reits in Japan gained 29.8 per cent in
      PHOTO: REUTERS  -  403 words
    • Article, Illustration
      Lock icon GIC more cautious in going for higher returns
      548 15 Chief investment officer prepares for ‘end game’ BLOOMBERG THE Government of Singapore Investment Corporation (GIC), which manages more than US$100 billion (S$125 billion) of assets, said it is more cautious about seeking higher returns as yields remain low ahead of the “end
      BLOOMBERG  -  548 words
    • Article, Illustration
      Lock icon Euro debt crisis almost over, says ex-Italian PM
      421 15  -  By ALVIN FOO alfoo@sph.com.sg FORMER Italian prime minister Mario Monti said in Singapore yesterday that the European debt crisis is almost over although the economic and social fallout remains. Mr Monti, who was in town for Deutsche Bank’s annual dbAccess Asia Conference,
      PHOTO: AGENCE FRANCE-PRESSE  -  421 words
    • MONEY SME SPOTLIGHT
      • Article, Illustration
        Lock icon Food supplier that’s a cut above the competition
        715 16 / 17  -  A lot of work goes into running a luxury hotel with many small companies needed to create that five-star experience. In this last part of a series on firms that help make a tourist’s stay in Singapore just that bit more memorable
        PHOTO: DESMOND LUI FOR THE STRAITS TIMES  -  715 words
      • Article
        Lock icon Tianjin Eco-City draws four more Singapore investors
        281 16 / 17  -  By RACHAEL BOON rachaelb@sph.com.sg THE Sino-Singapore Tianjin Eco-City will welcome four new Singapore companies, as investments in the emerging green city continue to rise. The companies inked deals with master developer Sino-Singapore Tianjin Eco-City Investment and Development (SSTEC) at a seminar on investment
        281 words
      • Article, Illustration
        Lock icon SME CLINIC
        411 16 / 17  -  Mr Chiew Yu Sarn partner, Yusarn Audrey L What is the value of protecting the intellectual property of my company’s products and services? Is this relevant for SMEs? Is your company selling generic products or services and competing only on price? If so, then intellectual property (IP) probably
        411 words
      • Article, Illustration
        Lock icon Upcoming SME events
        395 16 / 17 Lille: The smart place to do business in Europe L Date: May 29 L Time: 9am to noon L Venue: French Embassy, 101-103 Cluny Park Road Organised jointly by the Singapore Business Federation, Nord France Invest and the Embassy of France in Singapore, this seminar will provide
        ST FILE PHOTO  -  395 words
    • Article, Illustration
      Lock icon District 11 bungalow plot up for tender
      379 18  -  By MELISSA TAN melissat@sph.com.sg A FREEHOLD bungalow plot in plush District 11 expected to fetch more than $38 million was put up for sale by tender yesterday. That price works out to at least $1,686 per sq ft (psf) for the 22,534 sq
      PHOTO: SAVILLS SINGAPORE  -  379 words
    • Article
      Lock icon All policy inquiries will be seen to
      440 18  -  Online distributor will honour applications made before offer was scrapped FUNDSUPERMART’S INSURANCE REBATES By RACHAEL BOON rachaelb@sph.com.sg CLIENTS who had asked Fundsupermart about buying insurance policies will have their inquiries processed despite the closure of the controversial cut-price service after just four days.
      440 words
    • COMPANIES MONEY
      • Article, Illustration
        Lock icon Good news for two SGX-listed companies
        477 19  -  Plastoform exits watchlist; nod for Hafary to list on mainboard By JONATHAN KWOK jonkwok@sph.com.sg THE rise in popularity of Bluetooth audio speakers has helped Plastoform Holdings lift itself off the Singapore Exchange’s (SGX’s) dreaded watchlist of loss-making companies. Plastoform, a Hong Kongbased audio speaker
        PHOTO: HAFARY HOLDINGS  -  477 words
      • Article, Illustration
        Lock icon Boustead’s Q4 revenue up but profit down
        453 19  -  By MAGDALEN NG songyuan@sph.com.sg DIVERSIFIED engineering specialist Boustead Singapore has posted a 15 per cent decline in fourth-quarter net profit to $27.7 million from the same period last year. This was despite an 11 per cent increase in revenue for the quarter ended
        ST FILE PHOTO  -  453 words
    • MONEY MARKETS
      • Article
        Lock icon Caution rules on Asian stock markets
        422 20  -  STI slides 0.3% on profit-taking as investors await Bernanke testimony BULLS AND BEARS By ALVIN FOO alfoo@sph.com.sg SOME Asian markets ended softer yesterday as investors awaited fresh clues today to the future direction of stimulus measures in the United States. Caution reigned in the
        422 words
      • MARKET SUMMARY
        • Article, Illustration
          Lock icon STRAITS TIMES INDEX
          17 20 STI TRADING VOLUME 291.57 million shares STI UP DOWN Gainers: 13 Losers: 17 Unchanged:0
          17 words
        • Article
          Lock icon FTSE ST INDEXES
          85 20 Points Change Mid Cap Small Cap Fledgling Catalist China China Top Maritime 846.96 602.87 854.19 1,114.63 248.17 217.25 249.59 -2.26 -1.10 5.76 4.67 -0.88 -1.14 -0.51 Points Change Basic materials Consumer goods Consumer serv Financials Health care Industrials Oil and Gas 203.72 524.12 894.48 896.64 1,433.09 869.42
          85 words
        • Article, Illustration
          Lock icon FTSE ST ALL-SHARE INDEX
          21 20 STOCK TRADING VOLUME 2.6 billion shares worth $1.7 billion UP& DOWN Gainers: 214 Losers: 209 Unchanged: 367
          21 words
        • Article
          Lock icon OVERSEAS MARKETS
          55 20 Yesterday’s close Index Change -126.66 23,366.37 15,381.02 1,981.09 2,305.114 1,030.744 1,787.38 Hang Seng Nikkei 225 Seoul Kospi Shanghai Comp Shenzhen Comp Bursa KLCI 20.21 -1.34 5.139 13.829 10.23 Yesterday’s close Index Change Jakarta Comp SET Thailand Sydney ASX 200 Monday's close Dow Nasdaq 5,188.759 1,643.43 5,180.057 15,335.28 3,496.432
          55 words
      • SINGAPORE STOCKS
        • Article
          Lock icon Top Movers (Stocks)
          138 20 For a full list of SGX stocks, warrants and bonds, visit btstocks.asiaone.com TRANSACTION DATE: MAY 21, 2013 Top Rises May 21 CENTS (0) DBXT FTVietnam 10US$ 2497 59.0 1.9 DBXT MSINDO 10us$ 1782 50.2 2.3 CIMBASEAN40 100S$D 1500 15.0 1.0 ...***** ComfortDelGro 219 10.0 4.8 Hyflux 6%
          138 words
        • Article
          Lock icon Straits Times Index Stocks
          59 20 52-WEEK CURRENCY LAST 'VOL DAY GROSS NET M CAP HIGH LOW COMPANY TRADED SALE +OR-'000 HIGH LOW YIELD P/E $MIL COMPANY CORRENCY LAST TRADED SALE +0R'VOL '000 DAY GROSS HIGH LOW YIELD NET P/E M CAP $MIL 226 135.5 CapMallsAsia 203 -3 3534 207 203 1.6
          59 words
        • Article
          Lock icon Scoreboard
          114 20 MAIN CATL TOTAL Up Down Unch Up Down Unch Up Down Unch Multi Ind 6 6 4 0 0 0 6 6 4 Manufacturing 64 44 40 10 8 10 74 52 50 Commerce 23 22 15 4 5 3 27 27 18 Tpt/Stor/Comms 15 20 9 2 1
          114 words
        • Article
          Lock icon Turnover
          177 20 TURNOVER (‘000) VALUE (‘000) MAIN CATL TOTAL MAIN CATL TOTAL Multi Ind 62,618 62,618 135,316 135,316 Manufacturing 256,062 118,250 374,312 179,811 17,760 197,571 Commerce 152,586 119,347 271,933 104,433 11,486 115,919 Tpt/Stor/Comms 125,279 13,886 139,165 194,896 5,450 200,346 Finance 132,960 1,902 134,862 198,187 1,155 199,342 Construction 105,937 409,943 515,880 35,984
          177 words
        • Article
          Lock icon Top Actives
          40 20 By Volume CENTS Vol CENTS Vol YHM 4.6 409,118,000 Kep REIT Bund Center Inv ...................28 45,759,000 216,274,000 Iniiopac 19.6 114,386,000 WE Hldgs 11 78,038,000 Golden Agri 57 Thai Beverage ..................67.5 24,568,000 HPH Trust US$ ...................82.5 23,797,000 39 51,619,000
          40 words
        • Article
          Lock icon Sibor
          30 20 (US$) (S$) (USS) (S$) 0.***** 0.***** SWAP Offer rates (S$) 0.***** ,0.***** 0.***** ,0.***** SWAP Mid rates (S$) ,0.***** 0.***** ,0.***** 0.***** SWAP Offer rates (S$) Source: Thomson Reuters
          30 words
        • Article
          Lock icon Interbank Currency Rates
          58 20 May21 Against S$ Against US$ Currencies Bid Offer Bid Offer S$/US$ to one unit of foreign currency: Against US$ Bid Offer S$/US$ to one unit of foreign currency: S$/US$ to 100 units of foreign currency: 1.2312 ***** 0.9806 0.9811 ***** ***** 0.9747 0.9746 1.6171 1.6179 1.2879 1.2880
          58 words
        • Article
          Lock icon Top Movers (Warrants)
          209 20 Top Rises May 21 CENTS SingTelMBePW*****1 2 17.6 0.3 CapitalaBPePW*****2A 3.6 16.1 0.5 CapitalaMBePW*****3 3.6 12.5 0.4 CapitalaMBeCW*****2 5.6 12.0 0.6 STI 3250MBePW*****8 1 11.1 0.1 SembMar MBeCW*****5 5 11.1 0.5 Sinarmas eW*****8 51 10.9 5.0 DBS MB ePW*****9 13.4 9.8 1.2 CN8200MBePW*****7 6.4 8.5 0.5 SembMar
          209 words
        • Article
          Lock icon Bonds
          28 20 Vol Company Last Sale +or-('000) +orVol (□DO) CapMallA2.15%*****1 100.8 CapMallA3.8%b*****2 104.1 -0.2 37 CityDev NCCPS 130 cd +2 1 DBS Bk 4.7% NCPS 100 ***** +4 0
          28 words
        • Article
          Lock icon ETF
          347 20 52-Wk Last Vol High Low Company Sale +/-(’000) Company Last 114.4 95.8 CIMB APAC Div 100US$ US114.4 1500 1246 CIMBASEAN40 100S$D 1500 +15 4 1217 706 CIMBAsean40 100US$ US1202 +5 1 ***** ***** DBXT AUD Bonds 5AU$ A***** -15 0 126 107.1 ABF SG Bond ETF 925 673 DBXT
          347 words
      • COMPANYBRIEFS
        • Article
          Lock icon Religare Health Trust
          143 20 RELIGARE Health Trust recorded distributable income of $20.145 million for the year to March 31, 1.9 per cent below the $20.539 million the business trust had forecast at its initial public offering last October. Revenue was 2.1 per cent ahead of the forecast at $49.63 million but
          143 words
        • Article
          Lock icon Keppel Corp
          62 20 KEPPEL Corp will sell 180 million units in Keppel Reit, or 6.7 per cent of the vehicle, for $1.555 each. Goldman Sachs is the placement agent for the transaction, expected to be completed on May 27. Keppel will raise $279.9 million before costs are deducted, and reduce its
          62 words
        • Article
          Lock icon Oakwell Engineering
          47 20 OAKWELL Engineering is in negotiations with a party regarding a proposed transaction. Neither the party nor the details of the transaction were specified in yesterday’s announcement. Oakwell said no terms have been finalised, and there is no certainty that the proposed transaction will be finalised.
          47 words
  • Page 13 Advertisements
Page thumbnail Page 14
  • Page 14 Advertisements
    • Advertisement
      Lock icon Page 14 Advertisements Column 1
      687 14 P|Bj J llu >Ji I y f mmenaq v EC S Citibank Cardmember’s Exclusive Preferred Card: letiijflfc citibank Cabin Size/24”/28” New Yorker Trolley Luggage with a mininum charge of $2,800/$3,500/$5,500 While stocks last. T&Cs apply. [ioanK n C«««~0ZMMMK r| I gage Ml Wl ■B 16D Romance of Mediterranean value Enjoy
      687 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 2
      206 14 'll SIM PROFESSIONAL DEVELOPMENT IGNITING THOUGHT LEADERSHIP FAZED BY A VOLATILE ECONOMY? HEAR HOW ONE ENLIGHTENED CEO TOOK FLIGHT AND SOARED HIGH at CEO CONVERSATIONS In a mere span of 5 years since its launch, AirAsia X is now the largest and most profitable low-cost carrier for long-haul flights. Azran
      206 words
Page thumbnail Page 15
  • Page 15 Advertisements
    • Advertisement
      Lock icon Page 15 Advertisements Column 1
      33 15 1 moreday before you can catch CeeLo! SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column
      33 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 2
      226 15 its? AZ @RAYA LEBAR Good Location Matters Minute drive AZ Raya Lebar offers an unmatched location fhaf adds a compefifive edge to your business. The planned MacPherson MRT interchange for Circle and Downtown Lines, just across the road, delivers convenience, while easy access to major expressways ensures excellent connectivity to
      226 words
Page thumbnail Page 16 / 17
  • Page 16 / 17 Advertisements
    • Advertisement
      Lock icon Page 16 / 17 Advertisements Column 1
      227 16 / 17 HP recommends Windows 8 Pro. Dressed for business. m Introducing the HP ElitePad. Unleash your productivity. Built for business with Windows 8 Pro and enterprise-class. And thanks to a suite of productivity-enhancing accessories like Smart Jackets, you can have a desktop PC experience when you’re in the office or a
      227 words
    • Advertisement
      Lock icon Page 16 / 17 Advertisements Column 2
      22 16 / 17 Read it in tomorrow DRAGON BOATING FOR HEALTH AND WORK It helps bank employee Andy Chen keep fit and learn about teamwork
      22 words
    • Advertisement
      Lock icon Page 16 / 17 Advertisements Column 3
      18 16 / 17 Do you have a question for a business expert? Send your SME-related queries to Yasmine Yahya at yasminey@sph.com.sg
      18 words
    • Advertisement
      Lock icon Page 16 / 17 Advertisements Column 4
      599 16 / 17 ADVERTISING FEATURE 0 SINGAPORE WORKFORCE SKILLS QUALIFICATIONS u How many times do I have to tell them? How can I make my instructions clearer?” “They require me to monitor their work! I would want to coach them to function more independently. “How do I foster greater commitment among my team
      599 words
Page thumbnail Page 18
  • Page 18 Advertisements
    • Advertisement
      Lock icon Page 18 Advertisements Column 1
      52 18 f :)5?+58 8B/ =:5=B. :)5, 9,?80=0* 70 ,0?=/5AA0/ 52?" :5?80::5//B 807 52?-9 ,0?=B*807,( :5/?+85: 9,?80=0* 70 ,0?=/5A5: 5+?:,5=’; :8B/ AB=,58 25:70 @=5?8B+ 200& :5A/?<5+ AB?/85**0/ 5+?:,5<583*06 :8B/ )5, 70 ,0?=/5AA0/ ***** 0-4/ 0!6 )8 4(!%14%# ...7$+ !6&1 -58" 0!%’ w C2,?7 0= 28B< =>,:? 8B/ AB52? 8-0@ D9:C:8B6#$ =1 C=,5%
      52 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 2
      33 18 1 moreday before you can catch Psy! SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column
      33 words
Page thumbnail Page 19
  • Page 19 Advertisements
    • Advertisement
      Lock icon Page 19 Advertisements Column 1
      28 19 16 TUDOR CLOSE PIE 1CTUDOR lUCLOSE PIE Buklt Timah Rd Dunearn Rd k Holland Village Holland Rd fo' Dempsey Hill To Orchard Rd-i Rare Dll Freehold Bungalow Land
      28 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 2
      59 19 Land Area 2,093.5 sqm (approx. 22,534 sq ft) MR 2008 Zoning "2-storey Bungalows" Regular well elevated plot Wide frontage measuring approx. 40 metres Ideal for redevelopment Approval for subdivision into 4 bungalows North-south orientation Near prestigious schools For Sale By Tender Closing: 28th June 2013 Friday, 3pm www.savills.com.sg SOLE AGENCY
      59 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 3
      26 19 A j -'FIND r THE ONES THAT FIT! C Recruit the right people through CATS Recruit. Call 1800 289 8822 or email i recruit@sph.com.sg to advertise.
      26 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 4
      934 19 Religare Health Trust (Registration Number *****06) (a business trust registered under the Business Trusts Act. Chapter 31A of Singapore) Notice of Books Closure Date Payment Date for Distribution for the Period from 19 October 2012 (the “Listing Date”) to 31 March 2013 Notice is hereby given that the Transfer Books
      934 words
Page thumbnail Page 20
  • Page 20 Advertisements
    • Advertisement
      Lock icon Page 20 Advertisements Column 1
      146 20 Lianne Wanbao/ Shin Min Daily News Soccer ews The Straits Times World News r n r f s; The Straits Times Singapore News The Business ..Times News The New Paper Lianne .Zaobao Soccer ews News rj SUBSCRIBE NOW FOR SPECIAL PRIVILEGES!’ MONTHLY SUBSCRIPTION RATE FROM ONLY $4.28* For billing and
      146 words
Page thumbnail Page 21
  • Page 21 Advertisements
    • Advertisement
      Lock icon Page 21 Advertisements Column 1
      58 21 NEWS CENTRE COUNTER, 1000 TOA PAYOH NORTH Tel: 1800-289-9988 (office hours) OPENING HOURS: Mon Fri: 8.30am to 9.45pm Sat, Sun a Public Holidays: 12.30pm to 9.45pm DOCUMENTS NEEDED: Advertiser's NRIC# Original Death Certificate Photograph MODE OF PAYMENT: Cash (Mon to Fri: 8.30am to 5.30pm)/Credit Card/Nets/Cheque Bookings made after office hours
      58 words
  • Obituary
    Lock icon Untitled
    2089 21 OBITUARIES 0 tr Jr HOW TING HAI Age: 83 Passed away peacefully on 20 May 2013. Dearly missed and fondly remembered by loved ones. Wife: Lim Geok Eng (deceased) Sons: Daughters-in-law: Grandsons: Granddaughter-in-law: Great Grandsons: How Sow Chuen Goh Took Poon Charlotte How Wen Chang Danny Leung Yan Wei Evan
    2,089 words
Page thumbnail Page 22
  • Page 22 Advertisements
    • Advertisement
      Lock icon Page 22 Advertisements Column 1
      102 22 <0 tt TRINITY CASKET PTE LTD "For this GOD is OUR GOD forever and ever; HE will be OUR GUIDE even unto Death." Psalm 48:14 "...that where I AM, there you may be also." John 14:3 YOUR RIGHT CHOICE For a Complete Dignified Funeral Service to suit any budget. TEL:
      102 words
Page thumbnail Page 23
  • Page 23 Advertisements
    • Advertisement
      Lock icon Page 23 Advertisements Column 1
      53 23 For the loved ones whom you remember. In Memoriam yr For e n q u i r i e s call Obituaries 1800-289-9988 6319-5192 (office hours) (after office hours) Bookings made after office hours for next day's publication are subject to space availability. Online advertisement bookingfor condolences: cat scon ntcr@sph.com.
      53 words
    • Advertisement
      Lock icon Page 23 Advertisements Column 2
      6 23 A In memory of loved one
      6 words
Page thumbnail Page 24
  • Page 24 Miscellaneous
    • Miscellaneous
      Lock icon Page 24 Miscellaneous Column 1
      169 24 SPORTS FIXTURES HIGHLIGHTS LOTTERY L Draw No. 2850/2013 #17 L J Monday, 20 May 2013 Group 1 Prize: $307,597 each 2 Winning Share(s) Sold at: 1) Lee Eng Trading Store, Blk 20IB Tampines Street 21 #01-1083 (One QuickPick Ordinary Entry) 2) NTUC FairPrice, 1 Pasir Ris Central Street 3, White
      169 words
    • Miscellaneous
      Lock icon Page 24 Miscellaneous Column 2
      230 24 Today Badminton Sudirman Cup Gp 2B: Netherlands v Canada (noon). Gp 2A: Russia v USA (6pm) Live, StarHub Ch203 HD Ch255. Basketball NBA Conference Finals Western, Game 2: San Antonio v Memphis (Live, StarHub Ch202, 9am). Cricket IPL Eliminator: Rajasthan Royals v Sunrisers Hyderabad (Live, StarHub Ch231, 10.15pm). Cycling Tour
      230 words
Page thumbnail Page 25
  • Page 25 Advertisements
    • Advertisement
      Lock icon Page 25 Advertisements Column 1
      72 25 WATCH THE VIDEO www.straitstimes.com Highlights of the mass game between Atletico Madrid and the students Download a QR code readerapp on your smartphone and scan this code for more information. MST GOLF BIGGER DEALS, GREATER SAVINGS! SSI I i i v THE MOST EXPLOSIVE SALE EVER. Up to 80% off
      72 words
Page thumbnail Page 26
  • SPORT
    • Article, Illustration
      Lock icon Hariss, Safuwan meet super agent
      345 26  -  By WANG MENG MENG meng@sph.com.sg ON Monday night, national footballers Hariss Harun and Safuwan Baharudin met a man who could make a massive difference in their careers. The man was none other than Jorge Mendes, the super agent managing world football star Cristiano Ronaldo and
      ST FILE PHOTO  -  345 words
    • Article, Illustration
      Lock icon SUNDRAM PROMISES GOOD SHOW
      759 26  -  All S’pore Selection players to get play time and they aim to entertain By FABIUS CHEN fabiusc@sph.com.sg IT HAS been a while since he last coached a match where the result was secondary. And V. Sundramoorthy needs no reminding that tonight’s Singapore Olympic Foundation-Peter Lim Charity
      ST PHOTO: AZIZ HUSSIN  -  759 words
    • Article, Illustration
      Lock icon Singapore to tap Zerka’s Euro experience
      339 26  -  FABIUS CHEN LESS than five years ago, Monsef Zerka was scoring against the likes of Feyenoord and CSKA Moscow in the Uefa Europa League. Tonight, he will be transported back in time. The 31-year-old is set to line up for V. Sundramoorthy’s Singapore Selection
      ST PHOTO: NEO XIAOBIN  -  339 words
    • Article
      Lock icon ANCHORED PUTTING OUT
      434 23 Golf regulators say long clubs can be used but not pressed against the body ASSOCIATED PRESS AGENCE FRANCE-PRESSE WENTWORTH (England) Golf’s governing bodies approved a new rule yesterday that outlaws the putting stroke used by four of the last six Major champions, going against two major golf
      ASSOCIATED PRESS; AGENCE FRANCE-PRESSE  -  434 words
    • Article
      Lock icon Woods and Garcia in war of words
      141 23 ASSOCIATED PRESS BETHESDA (Maryland) Tiger Woods had a quick answer “No” as to whether he plans to make amends with Sergio Garcia. The feeling is mutual. Speaking at an event hosted by his sponsor TaylorMade-Adidas after Woods held a press conference to promote
      ASSOCIATED PRESS  -  141 words
    • Article, Illustration
      Lock icon ACJC net 5th straight title
      276 23  -  By GOH JUN YONG jygoh@sph.com.sg DEFENDING champions Anglo-Chi-nese Junior College (ACJC) clinched their fifth consecutive Schools National A Division netball title at the Toa Payoh Sports Hall yesterday. The girls put on a dominant performance and romped to a 63-36 victory over Hwa Chong Institution
      ST PHOTO: EDWARD TEO  -  276 words
    • SPORTS WORLD
      • Article
        Lock icon Bid to halt IPL thrown out
        62 24 REUTERS NEW DELHI India’s Supreme Court dismissed a petition yesterday seeking to scrap the remaining matches of the country’s lucrative Twenty20 cricket competition amid growing concerns about corruption in sport. Former Test bowler Shanthakumaran Sreesanth and two other players were arrested along with 11
        REUTERS  -  62 words
      • Article
        Lock icon Rooney cheered by birth of son
        61 24 LONDON Manchester United forward Wayne Rooney revealed his joy at becoming a father for the second time yesterday morning following the arrival of Klay. The 27-year-old announced the news on Twitter: “Our beautiful son Klay Anthony Rooney was born at 2.11am, weighing 7lb 111/2
        61 words
      • Article
        Lock icon 7 more horses test positive
        49 24 ASSOCIATED PRESS LONDON The Godolphin doping scandal deepened on Monday with the British Horseracing Authority announcing that seven more horses have tested positive for steroids. Trainer Mahmood al-Zarooni has already been banned for eight years after admitting to giving anabolic steroids to 15 horses.
        ASSOCIATED PRESS  -  49 words
      • Article
        Lock icon Pistorius out for rest of year
        31 24 AGENCE FRANCE-PRESSE JOHANNESBURG Murder-accused South African sprinter Oscar Pistorius will not race this season, his agent said yesterday, weeks before the Paralympian’s return to court.
        AGENCE FRANCE-PRESSE  -  31 words
      • Article
        Lock icon Brighton sorry over poop
        39 24 ASSOCIATED PRESS LONDON Brighton have apologised to Crystal Palace after excrement was found on the floor of their rivals’ away changing room before the second leg of their second-tier League Championship semi-final play-off last week.
        ASSOCIATED PRESS  -  39 words
    • Article, Illustration
      Lock icon JOSE FREE TO JOIN BLUES
      578 24 Controversial Mourinho released by Real after ‘insufficient’ achievements THE TIMES, LONDON AGENCE FRANCE-PRESSE MADRID Jose Mourinho will leave Real Madrid at the end of the season after three years at the Spanish club, paving the way for his expected return to Chelsea. The Portuguese coach’s
      THE TIMES, LONDON; AGENCE FRANCE-PRESSE; PHOTO: AGENCE FRANCE-PRESSE  -  578 words
    • Article
      Lock icon Aguero may seek Madrid return
      422 24 THE TIMES, LONDON LONDON As Manchester City launched their new Nike kit in the United States yesterday, the biggest question was whether star striker Sergio Aguero will be wearing it next season amid growing uncertainty over his future. Real Madrid retain a firm interest in
      THE TIMES, LONDON  -  422 words
    • Article
      Lock icon SCORES
      300 24 Badminton Sudirman Cup In Kuala Lumpur Group 1A: China bt Indonesia 5-0 (both teams enter q-finals). Gp 1B: South Korea bt Thailand 5-0 (both in q-finals). Gp 1C: Germany bt Malaysia 3-2 (Chinese Taipei Germany in q-finals). Gp 1D: Japan bt Denmark 3-2 (both in q-finals). Cycling Giro d’Italia
      300 words
    • Article, Illustration
      Lock icon Gunners target hit-man Higuain
      320 24 LONDON Arsenal are plotting a £19 million (S$36 million) bid to make Real Madrid striker Gonzalo Higuain their club-record signing in August. Armed with a £70 million transfer kitty, Arsene Wenger has made a world-class hit-man his priority, while also targeting a goalkeeper, a holding midfielder
      PHOTO: REUTERS  -  320 words
    • Article
      Lock icon Ferguson is bosses’ pick again
      219 24 REUTERS LONDON Manchester United manager Alex Ferguson capped his final season in charge of the English Premier League champions by clinching the League Managers’ Association (LMA) Manager of the Year award for the fourth time on Monday. The 71-year-old Scot’s unparalleled success in British football
      REUTERS  -  219 words
    • Article, Illustration
      Lock icon A TIGHT FIT BUT FUN FOR ALL
      78 25 Midfielder Saul Niguez (left picture, right) and striker Radamel Falcao (above) were among 12 Atletico Madrid players who took on a team of 128 pupils from 13 different primary schools yesterday at the Jalan Besar Stadium. Watched by Education Minister Heng Swee Keat,
      ST PHOTOS: NEO XIAOBIN  -  78 words
    • Article, Illustration
      Lock icon MEET THE TEAM BEHIND THE TEAM
      932 25  -  Backroom staff work tirelessly to support Atletico’s star-studded side By WANG MENG MENG meng@sph.com.sg LUNCH is served. The Atletico Madrid players remember the exact portions of their meal as recommended by the medical staff: 70 per cent carbohydrate in rice or pasta, 15 per
      ST PHOTO: AZIZ HUSSIN; ST PHOTO: NEO XIAOBIN  -  932 words
  • Page 26 Advertisements
    • Advertisement
      Lock icon Page 26 Advertisements Column 1
      62 26 Meet Atletico’s backroom team B23 Anchored putting ban from 2016 B25 Follow the on ST game live ST’s sports reporter Fabius Chen will be live blogging on www.straitstimes.com the Singapore Selection-Atletico Madrid game from 7.30pm. You can start following his coverage from 7.30pm onwards at the website, or follow updates
      62 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 2
      0 26 .&:@/'^-'/-^/;_<@-!{<_/'==./&&(
      0 words
Page thumbnail Page 1
  • Page 1 Advertisements
    • Advertisement
      Lock icon Page 1 Advertisements Column 1
      137 1 Actress in charge Forced to be social Online bombshell was a shy child C2 Big-name stars did not faze Charlie Young C3 Gnome invasion Chelsea Flower Show lifts ban for charity C10 Twelve years and five films after its debut, the Fast Furious franchise has graduated from B-movie to blockbuster.
      137 words
Page thumbnail Page 2
  • Life!
    • Article, Illustration
      Lock icon Shy start for bombshell
      798 2  -  Model-singer Amanda Lepore went from being shy to confident, even in see-through dresses Eddino Abdul Hadi Music Correspondent dinohadi@sph.com.sg It is hard to imagine va-va-voom transgender model Amanda Lepore as a wallflower. The American has fronted advertising campaigns for the likes of make-up giant M.A.C and
      PHOTOS: AMANDA LEPORE, ST FILE  -  798 words
    • Article, Illustration
      Lock icon Right Style for winning Psy impersonator
      339 2  -  Jan Lee Like hundreds of thousands of people around the world, events manager Ben Logan Sng started learning and performing the Gangnam Style dance last year. But the reason he did it is probably unique to him many people told him he looked like
      ST PHOTO: DESMOND WEE  -  339 words
    • Article, Illustration
      Lock icon Video-on-demand rising in popularity with TV viewers
      667 2 New York Times New York While companies weigh bids for Hulu and industry heavyweights complain that TV Everywhere is not going much of anywhere, another way to watch time-shifted television is quietly gaining traction: video-on-demand or VOD. It rarely gets media attention partly
      New York Times; PHOTO: ASSOCIATED PRESS  -  667 words
    • Movies LIFE!
      • Article, Illustration
        Lock icon Never too Young to direct
        520 3  -  Writing her first script and then directing it happened by chance, says Charlie Young Jan Lee janlee@sph.com.sg The cast of actress Charlie Young’s directorial debut Christmas Rose, revolving around a sexual assault case, is star-studded, to say the least. hey include critically acclaimed and veteran
        520 words
      • Article, Illustration
        Lock icon Christmas Rose fails to bloom
        476 3  -  Boon Chan Review Drama CHRISTMAS ROSE (PG13) 87 minutes/Opens tomorrow/ The story: Public prosecutor Tim (Aaron Kwok) takes on an explosive case in which handicapped piano teacher Jing (Guey Lun-mei) accuses well-known doctor Zhou (Chang Chen) of molesting her during a medical check-up. It all
        PHOTOS: SHAW ORGANISATION  -  476 words
      • Article, Illustration
        Lock icon FAST ROAD TO SUCCESS
        1459 4 / 5  -  The Fast Furious franchise started with a B-film, but has now earned over US$1.5 billion and beaten superhero blockbusters John Lui John Lui Film Correspondent In Manila johnlui@sph.com.sg The Fast Furious story began in 2001 as an exercise in trash-movie excess. Its relatively modest US$38-million budget
        PHOTOS: UIP, ASSOCIATED PRESS  -  1,459 words
      • Article, Illustration
        Lock icon Bourdain explores Congo and Libya
        706 4 / 5 Bloomberg Anthony Bourdain gets to travel around the world having adventures and eating great food his new network, CNN, has already ordered another season of Parts Unknown. Back in New York, Bourdain is a fan of the Bronx Academy of Letters, which helps students develop
        Bloomberg; PHOTO: CNN INTERNATIONAL  -  706 words
      • Article, Illustration
        Lock icon Fast cars that are just crazy
        585 4 / 5  -  Will Lawrence In London The studios at Longcross in Surrey, England, are throbbing with activity. The cast and crew of the Fast Furious franchise have hit the United Kingdom to shoot the sixth instalment of their US$1.5-billion (S$1.9-billion) action series and they are planning
        585 words
      • Article, Illustration
        Lock icon Furious action saves weak acting
        599 4 / 5  -  John Lui Review Action FAST FURIOUS 6 (PG13) 130 minutes/Opens tomorrow/ The story: Following the events of the last film, the team is now scattered across the globe, unable to return to the United States because they are wanted criminals. In Russia, a convoy is
        599 words
      • Article, Illustration
        Lock icon Striking a fine balance
        468 6  -  Matthew Fox channels his brand of decency as the man tasked with investigating the emperor Boon Chan bchan@sph.com.sg Review Drama EMPEROR (PG13) 105 minutes/Opens tomorrow/ The story: World War II is over and Japan has surrendered. General Douglas MacArthur (Tommy Lee Jones) arrives in Tokyo for
        PHOTOS: CATHAY ORGANISATION, CATHAY-KERIS FILMS  -  468 words
      • Article
        Lock icon Disney to make Star Wars cartoon
        375 6 Reuters Los Angeles Disney said on Monday it will produce a new Star Wars animated series to air on television in the second half of next year, giving fans of the science-fiction franchise fresh stories before the next live-action film hits theatres in 2015.
        Reuters  -  375 words
      • SHORT CUTS
        • Article, Illustration
          Lock icon AT ANY PRICE
          219 6  -  Review Drama Boon Chan 104 minutes/Opens tomorrow/ This week’s other movie with fast and furious racing cars stars Zac Efron (right, with co-star Maika Monroe as Cadence) as Dean Whipple, a restless young man stuck in rural small-town America. His father, Henry (Dennis Quaid), is a bitter
          PHOTOS: CATHAY-KERIS FILMS & INNOFORM MEDIA, GOLDEN VILLAGE  -  219 words
        • Article, Illustration
          Lock icon THALE(NC16)
          177 6  -  Review Horror Dave Chua 76 minutes/Opens tomorrow/ When Elvis (Erlend Nervold, right) and Leo (Jon Sigve Skard) perform a clean-up of a derelict hut in the Norwegian forest, they encounter a strange female (Silje Reinamo, far right) with a dark secret. This low-budget Norwegian horror movie that taps into
          177 words
      • HOT TRAILERS
        • Article, Illustration
          Lock icon INSIDE LLEWYN DAVIS
          133 6 www.youtube. com/watch?v=LFphYRyH7wc A bearded folk singer, Llewyn Davis (Drive’s Oscar Isaac, above), journeys through New York in the 1960s like a sad-sack Bob Dylan with a guitar, a cat and a look of looking for nothing in particular. Under-lit clubs, subways and dingy toilets abound in this
          133 words
        • Article, Illustration
          Lock icon RIDDICK
          163 6  -  Tay Yek Keak www.youtube.com/watch?v=tDxDEjDMreA Because 2004’s The Chronicles Of Riddick was such a dud when alien-fighter Riddick (Vin Diesel, above) “the man who can see in the dark” was put in fancy civilised surroundings, this time, it’s back to the bare-bones survivalist mode of the original Pitch Black (2000).
          PHOTOS: YOUTUBE  -  163 words
      • Article, Illustration
        Lock icon Whimsical and wise
        653 7  -  This mature follow-up from Au Revoir Taipei’s director confronts serious themes in a light way Yip Wai Yee yipwy@sph.com.sg Review Romantic Comedy WILL YOU STILL LOVE ME TOMORROW? (R21) 106 minutes/Opens tomorrow/ The story: Mild-mannered optician Weichung (Richie Jen) and office clerk Feng (Mavis Fan), who have
        PHOTOS: FESTIVE FILMS  -  653 words
    • Article, Illustration
      Lock icon Go ahead QUOTE ME
      144 8 ‘You get Bart Simpson, skateboarding, saying “Don’t have a cow, man,” but when you’re 70 years old, it’ll say “rgadgkhlaskdfha” and no one is going to know. And you’re going to have to explain who the Simpsons were’ Talk show host Jimmy Fallon (right) on why
      144 words
    • Article, Illustration
      Lock icon Park here for laughs
      529 8  -  Singer Jay Park is not afraid to act silly as the new host of Saturday Night Live Korea Jan Lee janlee@sph.com.sg Too many hip-hop artists are overly concerned with being cool and tough, and want to be seen to have street credibility. Not the Seoul-based Jay
      PHOTO: LIANHE ZAOBAO  -  529 words
    • Article
      Lock icon Cassette tape gets a rewind
      306 8 BBC News London The humble cassette tape, a happy memory for many music fans of a certain age, has staged a comeback for one Canadian company. The first order came in 1989: 10 cassettes. With that began Analogue Media Technologies, a company created to help
      BBC News  -  306 words
    • Article, Illustration
      Lock icon Doors founder dies
      691 9 Keyboardist Ray Manzarek, 74, of 1965 band succumbs to bile duct cancer New York Times Associated Press Agence France-Presse New York Ray Manzarek, who as the keyboardist and a songwriter for The Doors helped shape one of the indelible bands of the psychedelic era, died on Monday
      New York Times; Associated Press; Agence France-Presse; PHOTO: ASSOCIATED PRESS  -  691 words
    • Article, Illustration
      Lock icon Gnome invasion
      726 10 Garden figures turn up in London to celebrate the Chelsea Flower Show’s 100th anniversary Reuters London Some spectators at London’s Chelsea Flower Show would not be caught dead with one in the boot of their Bentley, but garden gnomes have turned up at the show’s 100th edition this
      Reuters; PHOTOS: AGENCE FRANCE-PRESSE, DEMOTIX; PHOTO: ASSOCIATED PRESS  -  726 words
    • Article, Illustration
      Lock icon Daft Punk stays deft
      1135 11 French electronic duo Daft Punk’s new album aims to bring the human out of the robot Associated Press Los Angeles It is tempting to say Daft Punk has gone Hollywood. The influential French electronic duo crafted their first film score, for Tron: Legacy, three years ago
      Associated Press; PHOTO: ASSOCIATED PRESS  -  1,135 words
    • Article, Illustration
      Lock icon US political satirists are big in China
      578 12 Comics such as Jon Stewart have huge fan bases in a country where criticism is suppressed Reuters Shanghai Humour may not always translate well, but Jon Stewart is picking up millions of fans in China, where his gloves-off political satire is refreshing for
      Reuters; PHOTOS: REUTERS, AGENCE FRANCE-PRESSE  -  578 words
    • Article
      Lock icon Watch Shakespeare’s sonnets performed via app
      358 12 Reuters Toronto A new app launched on Monday aims to bring William Shakespeare’s sonnets to the masses with the help of short films starring stage actors performing them in front of New York landmarks. The Sonnet Project is a free app for the iPhone
      Reuters  -  358 words
    • LIFE! Buzz
      • Article, Illustration
        Lock icon Moses Chan to marry
        241 14 Hong Kong TVB leading man Moses Chan might be married and a first-time dad before the year is out, latest reports seem to indicate. His actress girlfriend Aimee Chan’s sudden withdrawal from a lead role in a TVB drama after feeling out of sorts while filming
        PHOTO: APPLE DAILY  -  241 words
      • Article, Illustration
        Lock icon Japan vengeance film booed in Cannes
        418 14 Agence France-Presse Associated Press Cannes, France A blood-soaked vengeance tale from Japan drew the biggest boos in the race for the Cannes Film Festival’s top prize on Monday, with critics savaging a “risible” parade of cliches. Controversial Japanese director Takashi Miike unveiled Shield Of
        Agence France-Presse; Associated Press; PHOTOS: INVISION, AGENCE FRANCE-PRESSE  -  418 words
      • Buzzing
        • Article
          Lock icon DESTINY’S ROWLAND IN X FACTOR
          65 14 Simon Cowell has added former Destiny’s Child singer Kelly Rowland, 32, and Latin artist Paulina Rubio, 41, to the cast of his show The X Factor. With Cowell and singer Demi Lovato, 20, the singers will be on the show when it starts its third
          65 words
        • Article
          Lock icon MACFARLANE NOT HOSTING OSCARS
          47 14 Seth MacFarlane is too busy to host the Oscars next year. The comic says on Twitter that he “tried to make it work schedule-wise, but I need sleep”. He had mixed reviews for his first outing as Oscars host in February this year.
          47 words
        • Article
          Lock icon LI BINGBING IN TRANSFORMERS 4
          40 14 Paramount Pictures said it has added Chinese actress Li Bingbing to the cast of Transformers 4. She will join Mark Wahlberg and Stanley Tucci in the film, which will hit theatres in June next year.
          40 words
        • Article
          Lock icon CHUNG BREAKS UP WITH BEAU
          70 14 Gillian Chung has split up with her KoreanAmerican impresario beau Tyler Kwon, reported Oriental Daily. It said she has stopped following Kwon on Weibo and so has her bandmate Charlene Choi. Chung and Kwon, who were first reported as a pair last November, have been
          70 words
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      170 2 FUTURE TRANSI ASIA 2013 25 27 June 2013, Grand Hyatt Jakarta SB? 'N SMART TRANSPORT-SMARTER FUTURE Register early to enjoy great savings! Visit our websites at www.smartpassengerrail.com.sg www.smartterminal.com.sg www.smarttraffic.com.sg to register or email Jiahui at jiahui@sphereconferences.com Unveil new strategies and solutions for operators and government authorities from aviation, rail and
      170 words
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      146 3 CHINESE For Children... We Specialise In It! (7 Jun 30 Jun) K1 to P4 5-Day Fun-With-Mandarin Workshops 5 days of fun and excitement (Mon-Fri, 9am-5pm) Include lunch, tea and materials Speech Oral training by professional teachers Two workshops of different activities Workshop A (Group 1:10-14 June Group 2:17-21 June) Day
      146 words
    • Advertisement
      Lock icon Page 3 Advertisements Column 2
      248 3 Vouchers Gifts up for Grabs!! THIS CHEAT SIHOA SATE s v>. Hk aft ’•s f r S A Robinsons OR Takashimaya Vouchers !^AA'»-28j ul lO Vouchers Gift set; TOTAL WORTH OF v-:« an •->> w o iio i .^InKo Digital Bathroom Scale >S V S v 3 A' t V
      248 words
Page thumbnail Page 4 / 5
  • Page 4 / 5 Advertisements
    • Advertisement
      Lock icon Page 4 / 5 Advertisements Column 1
      19 4 / 5 100.5 S i UFM 00 3 coco ijftmUFMlOO.3 fe&itkPff! ap up DOWNLOAD THE UFM 100.3 MOBILE APR NOW! WWW.UFM1003.SG
      19 words
    • Advertisement
      Lock icon Page 4 / 5 Advertisements Column 2
      36 4 / 5 WATCH THE VIDEO www.straitstimes.com Do Fast Furious 6 stars know how much cars cost in Singapore? JOHN LUI quizzes them. Download a QR code reader app on your smartphone and scan this code for more information.
      36 words
    • Advertisement
      Lock icon Page 4 / 5 Advertisements Column 3
      62 4 / 5 3 Reasons Classifieds -+>@;B> +7<>/+))+ ++B) 53 2: 5: "5DE!3, !3E3F% 3E %C 2:3=%; *****#4! 0#: !21 1 25: !0E:4D=%C2 #3$ *84:9DED"0= !D !20D$D!!:=/>@ 0!:0#45D 3E 302DA 25: 233" $3 !045:F4 21 #C38 3E 0!53%!0# FED? .++B) 8=0EC=3!6: 20F4:EE: !"5D#E! 35 34>4-/*****=<0!" 6, #">4-/*****=<0!" #"4-/*****=<0!" > -(81 +6 -2=5 69(48
      62 words
Page thumbnail Page 6
  • Page 6 Advertisements
    • Advertisement
      Lock icon Page 6 Advertisements Column 1
      109 6 mim reins P REMUS'S fMR/ •1* mn.miti* -j 3sT»ia sill* 10-12 July 2013 Level 1, Hall B&C Marina Bay Sands, Singapore Organised By: B| I I K I IS Blk 8 Lorong Bakar Batu, I L L I IN lv #07-07 Singapore *****3 Exhibition Services Pte Ltd Tel: (65) 6848
      109 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 2
      11 6 www.omy.sg |J IM 'W I"" 1111 Ip sc < I fr lifestyle.omy.sg
      11 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 3
      56 6 WATCH THE VIDEO www.straitstimes.com Scan to view the trailer of Inside Llewyn Davis. Download a QR code reader app on your smartphone and scan this code for more information. WATCH THE VIDEO www.straitstimes.com Scan to view the trailer of Riddick. Download a QR code reader app on your smartphone and
      56 words
Page thumbnail Page 7
  • Page 7 Advertisements
    • Advertisement
      Lock icon Page 7 Advertisements Column 1
      207 7 -'“•Wiki S ■J a n Ma\> SPH Gift of Music concert series is inviting you to let your hair down and have fun at our upcoming weekend concerts which v celebrate the lighter side of life. Budak Pantai Puts Hair On Your Chest Esplanade Outdoor Theatre Thursday Friday, 23 24
      207 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 2
      467 7 Transform Yourself To Be An Influential Successful Leader Who should attend: Senior and Middle Management, General Management, Supervisors, Marketing PR Consultants, and Sales and Business Development Personnel M i Productivity and Innovation Credit (PIQ Claimable 2013 MAY SERIES FULL-DAY WORKSHOPS SPH News Centre (9.30am to 6.00pm) EQ Leadership 29 MAY'13
      467 words
  • Page 7 Miscellaneous
    • Miscellaneous
      Lock icon Page 7 Miscellaneous Column 1
      101 7 Top 10 movies SINGAPORE 1. Star Trek Into Darkness 2. (1) Iron Man 3 3. The Great Gatsby 4. (2) Evil Dead 5. (3) The Big Wedding 6. (4) The Call 7. My Phone Sex Partner 8. (5) Scary Movie 5 9. The Incredible Truth 10. Guilty Of Romance Information
      101 words
Page thumbnail Page 8
Page thumbnail Page 9
  • Page 9 Advertisements
    • Advertisement
      Lock icon Page 9 Advertisements Column 1
      34 9 1 moreday before you can catch Jessica Alba! SOCIAL STAR AWARDS AND SINGAPORE SOCIAL CONCERTS To get tickets, go to www.straitstimes.com and click on the Singapore Social Concerts Big Story on the right-hand column
      34 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 2
      208 9 CALL FOR PERFORMERS Step Right Up! Be part of ChildAid 2013 CarnivalEdition Young ladies gentlemen, step right up! If you think you can sing, dance, play a musical instrument or perform a circus act, come try out for our next ChildAid concert! Email your entry to childaid@sph.com.sg by June 8,
      208 words
Page thumbnail Page 10
  • Page 10 Advertisements
    • Advertisement
      Lock icon Page 10 Advertisements Column 1
      111 10 U always! like us on D facebook/ufmlOOS follow us on twitter@ufml003 www.ufml003.sg UFM 100.5 S i CJS It U SHINE Take a step back. Reflect on life. As we get caught up in the hustle and bustle of daily life, let's pause and be thankful for all that we have.
      111 words
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      47 11 Asia's best outdoors magazine <_ '7 si ft tlLd ASIA GETS ON «u ITS BIKE BS xnes r v WK2r* is t-nuip’;, Wife '>SS5= Free supplement with latest issue Digital version now available on iPad Android! Subscribe at www.actionasia.com Mm or email sub@bluincmedia.com A SUBSIDIARY OF SPH MAGAZINES
      47 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 2
      10 11 TAMIL ACTOR DHANUSH MAKES BOLLYWOOD DEBUT GET YOUR COPY TOMORROW
      10 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 3
      33 11 TOMORROW IN THE WOLF bid farewell to the series that made them famous PACK S BACK The madcap guys of The Hangover Part III bid farewell to the series that made them famous
      33 words
  • Page 11 Miscellaneous
    • Miscellaneous
      Lock icon Page 11 Miscellaneous Column 1
      18 11 Tdy: I 2.50pm 7.30pm Tdy: 4.55pm 9.35pm .for all show times and online bookings today, logon to www.in-movienetwork.com
      18 words
    • Miscellaneous
      Lock icon Page 11 Miscellaneous Column 2
      86 11 .exhilarating, non-stop, M .action supercharged.” jump-out-your-seat action.” James Mottram, Total Film m n PG 13 x m Uii; gy REX CINEMAS 2 Mackenzie Road www.rexcinema.com.sg T FaceBook Group Rex Cinemas “ETHIRNEECHAL” (pgis) Consumer Advice; Some Coarse Language REX 1: 12r 3.00pm, 6.00pm, 9.00pm SOODHU KAVVUM” pg) REX 2: 6.00pm, 8.30pm
      86 words
    • Miscellaneous
      Lock icon Page 11 Miscellaneous Column 3
      558 11 LIDO SHAW HOUSE LEVEL 5 JCUBE 2 JURONG EAST CENTRAL 1 LEVEL 4 nex nex SERANGOON CENTRAL LEVEL 4 BALESTIER SHAW PLAZA LEVEL 4 LOT ONE LEVEL 5 LOT 1 CHOA CHU KANG EUROPEAN UNION FILM FESTIVAL HEAVY GIRLS(M18)✱✱ 7:00pm (NUDITY SOME HOMOSEXUAL CONTENT) AMOUR(NC16)✱✱ 9:30pm (SOME NUDITY) FASTANDFURIOUS6 (PG13)(CS)✱
      558 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      162 12 (§L ric cognitive approach Enhance Your Child’s Brain Exam Results (5-i7yrsoid) ric cognitive approach is a scientific method to develop students'intellectual abilities. a I u v I ■V Delivered by Professional Practitioner/ Cognitive Psychologist The benefits include: Neurodevelopment Superior learning memory abilities Better academic performance Registration (Sat/Sun 10am-5pm) 0Holiday Program
      162 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 2
      5 12 to ■^i m &r.vR- a
      5 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 3
      24 12 I LIGHTNING STRIKES CATCH THE ALL NEW NISSAN HOT FM91.3 THUNDER TRUCK TUNE IN TO HOT FM91.3 FOR MORE INFO WWW.HOTFM.SG FACEBOOK.COM/HOTFMSG S* HOTFMSG
      24 words
Page thumbnail Page 13
  • Page 13 Advertisements
  • Page 13 Miscellaneous
    • Miscellaneous
      Lock icon Page 13 Miscellaneous Column 1
      1436 13 starhub tv disney xd ch310 AM 6.00 Oscar’s Oasis 7.00 Kick Buttowski Suburban Daredevil 8.00 Phineas And Ferb 9.00 Ultimate Spider-Man 9.30 Digimon Fusion Battles 10.00 Ryukendo 11.00 Redakai PM 12.00 Ninja Warrior 1.00 Kick Buttowski Suburban Daredevil 2.00 Phineas And Ferb 3.00 Scaredy Squirrel 3.30 Randy Cunningham: 9th Grade
      1,436 words
    • Miscellaneous
      Lock icon Page 13 Miscellaneous Column 2
      1134 13 CRAZY, STUPID, LOVE (NC16) HBO (StarHub TV Channel 601), 8pm When Cal’s wife Emily asks him for a divorce, he turns to a new friend (Ryan Gosling) to help him learn to pick up girls at bars. Stars Steve Carell and Julianne Moore (both right). NIKITA (SEASON FINALE) Season Pass
      1,134 words
    • Miscellaneous
      Lock icon Page 13 Miscellaneous Column 3
      1042 13 mio tv discovery kids ch230 AM 6.00 The Mysteries Of Alfred Hedgehog 6.30 Head Rush 7.30 All For Kids 8.00 Animal Atlas 2 8.30 Deadly Art 2 9.00 The Mysteries Of Alfred Hedgehog 9.30 The Green Squad 10.00 Papyrus 2 10.30 Dick ’N’ Dom Go Wild! 11.00 Horrible Histories 3
      1,042 words
Page thumbnail Page 14
  • Page 14 Advertisements
    • Advertisement
      Lock icon Page 14 Advertisements Column 1
      98 14 sfli rewards > I > If my feet don’t hurt it’s not shopping’' moment. Too much excitement will have unexpected moments, but will surely liven up your day. You’ll always be in for a treat with perks that’s exactly what you’re looking for. Get exclusive access to attractive rewards dining
      98 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 2
      18 14 Read it in tomorrow GO VEGETARIAN FOR VESAK DAY Make a salad with mock chicken, vegetables and fruit
      18 words
Page thumbnail Page 1
Page thumbnail Page 2
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      212 2 V M Adobe All-new tools. All-new offers. Only in Creative Cloud. Get everything you need to create with one convenient Adobe Creative Cloud membership, now available for individuals, teams and enterprises. What's included: Access to the entire collection of Creative Cloud desktop applications and services, including Adobe Photoshop*CC, InDesign*CC, Illustrator*
      212 words
Page thumbnail Page 1
  • Page 1 Advertisements
Page thumbnail Page 2
  • DL digital life
    • Commentary
      • Article, Illustration
        Lock icon Spoilt for choice by free content
        618 2  -  Sherwin Loh sherwinl@sph.com.sg I first dabbled in pirated content when I was in secondary school. A friend owned a Nintendo Entertainment System; another had the Sega Mega Drive. After school, a group of us would descend upon their homes to duke it out in
        618 words
      • Article
        Lock icon WHAT FANS SAY
        176 2 facebook On lacklustre demand for Nintendo Wii U, and news of the PlayStation 4 and new Xbox game console: I plan to stick to PlayStation 4. Nintendo was good only during the Game Boy era. Alvin Chong The Wii U has the potential; it just needs the
        176 words
    • News
      • Article, Illustration
        Lock icon How secure is Office 365?
        452 3  -  Small businesses learn more about data security features of Office 365 in a seminar by DL and Microsoft. AARON TAN reports reports AARON TAN aarontan@sph.com.sg Before Kah Motor jumped onto the cloud computing bandwagon, data security was a key concern for its top executives. The
        ST PHOTO: AZIZ HUSSIN  -  452 words
      • TECH BYTES
        • Article, Illustration
          Lock icon Mobile subscriptions will exceed world’s population soon
          128 4 The number of mobile phone subscriptions will top the world’s population by the end of next year, according to the International Telecommunications Union. As of now, the world’s population stands at 7.1 billion. There are 6.9 billion mobile phone subscriptions. The report also
          PHOTO: AGENCE FRANCE-PRESSE  -  128 words
        • Article
          Lock icon Gmail users can now expand size of mailboxes
          75 4 Google is now offering users 15GB of online storage to be shared across Gmail, Google Drive and Google+ Photos. Previously, Gmail storage was capped at 10GB, while Google Drive and Google+ Photos enjoyed a combined storage limit of 5GB. This is good
          75 words
        • Article
          Lock icon Samsung claims to have developed ‘5G technology’
          61 4 Just as consumers here are warming up to 4G networks, Samsung claims to have achieved “5G” data transfer speeds of up to 1Gbps across distances of up to 2km. It said that by 2020, devices using its 5G technology could offer mobile data
          61 words
        • Article
          Lock icon Microsoft updates Skype for Windows Phone 8 and Windows
          78 4 The Skype app for Microsoft’s phone and desktop operating systems has been refreshed to make chat and call notifications more reliable. The update has also fixed the issue of occasional missing message preview in the recent conversations list. Not all the
          78 words
        • Article
          Lock icon Irish mobile device insurer launches its services here
          101 4 Irish mobile device insurance Mobilecover has brought its mobile phone and tablet insurance service to Singapore. Launched last week, the service will insure your phone or tablet for premiums starting at $5.49 a month. The cost depends on the device. Higher-tier plans
          101 words
        • Article
          Lock icon Sony back in the black for the first time in five years
          73 4 The Japanese electronics giant is finally making money for the first time in five years, thanks to a weaker Japanese yen that boosted sales. However, much of its earnings were attributed to the sale of its US headquarters
          73 words
        • Article
          Lock icon Samsung Galaxy Note 3 will have a 6-inch display
          65 4 The latest Galaxy Note is expected to sport a 6-inch Amoled screen with a full high-definition resolution of 1,920 x 1,080 pixels, according to online news sources. The device is said to be powered by Samsung’s eight-core Exynos Octa 5 processor,
          65 words
        • Article
          Lock icon S’pore Dell store first to adopt global brand guidelines
          70 4 Dell has revamped its concept store at Funan DigitaLife Mall with a new contemporary and bold design. According to the PC maker, the new store touts “experience suites that allow customers to experience technology as they would in real life”. The
          70 words
        • Article
          Lock icon Chrome and Android to stay separate, says Android boss
          90 4  -  Compiled by Aaron Tan Google’s newly minted head of Android, Mr Sundar Pichai, told Wired magazine recently that both Android and Chrome are large open platforms that will provide choices for users and developers in a world where people embrace multiple
          90 words
    • Spotlight
      • Article, Illustration
        Lock icon Free style
        614 6 / 7  -  You can have everything from e-books to games for nothing. AARON TAN finds out why companies big and small give stuff away AARON TAN aarontan@sph.com. sg Giving away a product for free may have seemed radical in the early part of the 20th century, but King Gillette, inventor
        ST ILLUSTRATION: TANG WEE CHEOW  -  614 words
      • Article, Illustration
        Lock icon Videos
        448 6 / 7  -  A number of websites let you stream movies and TV shows for free legally. TREVOR TAN tries out three of them TREVOR TAN Crunchy Roll www.crunchyroll.com This website caters to anime fans with its large line-up of anime videos, such as Naruto Shippuden and Eyeshield 21. These shows are
        448 words
      • Article, Illustration
        Lock icon E-books
        399 6 / 7  -  Many e-book providers offer free e-books to entice users to sign up. AARON TAN finds out where you can go to read books for nothing AARON TAN Project Gutenberg www.gutenberg.org This offers more than 42,000 free e-books that can be accessed from its website or read on e-readers. Its
        399 words
      • Article, Illustration
        Lock icon Music
        625 8 / 9  -  SHERWIN LOH finds out where you can get free music streaming and downloads SHERWIN LOH STREAMING MUSIC Spotify spotify.com Deezer www.deezer.com Search giant Google announced its Google Play Music All Access streaming service in the United States last week, but there are already music streaming services here that offer
        625 words
      • Article, Illustration
        Lock icon Games
        421 8 / 9  -  Everyone loves free games and you can find them if you know where to look, says OO GIN LEE OO GIN LEE PlayStation Network, Xbox Live Xbox 360 and PlayStation 3 console games are not cheap, but there are some good deals available for download from the respective Xbox
        421 words
      • Article, Illustration
        Lock icon Comics
        474 8 / 9  -  Read the exploits of Iron Man and other superheroes at no charge, reports SHERWIN LOH reports SHERWIN LOH Marvel Comics (right) Android, iOS American comic books are like daytime soaps they stay around for the longest time and the popular ones show no sign of stopping. The good thing
        474 words
      • Article, Illustration
        Lock icon Software
        899 10  -  AARON TAN susses out the best free software to enhance your digital lifestyle, help you stay productive and keep your PC humming AARON TAN DIGITAL IMAGING Photoscape www.photoscape.org This image editor features a variety of fun and easy-to-use tools that will help you spruce up your vacation photos. You
        899 words
    • Phones
      • Article, Illustration
        Lock icon PowerSkin Battery Case for iPhone 5
        531 11  -  By Trevor Tan trevtan@sph.com.sg There are many plus points about the Apple iPhone 5 but battery life is definitely not one of them. This is why you may need a case that doubles as a battery charger, such as the new PowerSkin Battery Case
        531 words
      • Article, Illustration
        Lock icon SETTING UP A BASE STATION
        293 12 First hour JCable trunking is installed. Second hour JThe base station, which is the size of about two large household refrigerators and weighs more than 600kg, is unloaded along with its eight back-up battery packs. The battery packs can altogether last for four hours in
        ST PHOTOS: ALPHONSUS CHERN  -  293 words
      • Article
        Lock icon SingTel bumps up network speeds at Junction 8
        494 12  -  DERRICK HO follows the telco’s crew as they set up a second mobile base station at the mall DERRICK HO derrickh@sph.com.sg It was 10.15pm on April 16 and most stores at Junction 8 in Bishan were already shuttered. Store assistants, done for
        494 words
      • Article, Illustration
        Lock icon Maybank KE Trade SG
        447 13  -  By Oo Gin Lee ginlee@sph.com.sg I have bought only one stock in my entire life and only because I thought it would be fun to do so as AsiaOne was spun off at that time from the company I work for Singapore Press Holdings. When it
        447 words
    • Photos
      • Article, Illustration
        Lock icon Panasonic’s new mirrorless system cameras
        943 14 / 15  -  By Trevor Tan trevtan @sph. com. sg Picturesque Bali is the perfect place to give Panasonic’s latest mirrorless system cameras, the Lumix DMC-G6 and DMC-GF6, a workout. With sights from the splashing waves of Nusa Dua’s Water Blow to the tranquil beaches of Seminyak, I
        943 words
      • Article, Illustration
        Lock icon Sony Cyber-shot DSC-HX300
        500 16  -  By Mike Lee Mike Lee is a freelance photographer and writer Sony’s latest ultra-zoom prosumer camera resembles an entry-level DSLR fitted with a 50mm prime lens. However, unlike such D LRs, the DSC-HX300 covers a much wider and longer range with a 24-1,200mm (35mm equivalent) focal length,
        500 words
    • Tablets
      • Article, Illustration
        Lock icon Logitech Ultrathin Keyboard Cover mini
        549 17  -  By Trevor Tan trevtan @sph. com.sg Last year, I reviewed the Logitech Ultrathin Keyboard Cover for Apple iPad (2nd generation and above) and found it to be the most convenient iPad Bluetooth keyboard around. Now, this is a slimmed down version for the iPad mini.
        549 words
    • PCs
      • Article
        Lock icon Intel’s Haswell chips to save the PC industry?
        649 18  -  Intel’s fourth-generation Core processors will improve on battery life and CPU performance. reports VINCENT CHANG Vincent Chang is a freelance writer It is not a good time to be in the PC industry. Just ask HP. The world’s largest PC vendor posted
        649 words
      • Article, Illustration
        Lock icon Asus VivoTab
        523 18  -  By Vincent Chang The Asus VivoTab is the latest Windows 8 hybrid to hit the market. A cross between laptop and tablet, such as those in Asus’ ransformer series of Android tablets, the VivoTab is a slate with a keyboard dock. Attach the tablet to the dock to
        523 words
    • Gaming
      • Article, Illustration
        Lock icon PREVIEW: Civilization V: Brave New World
        556 19  -  By Oo Gin Lee ginlee@sph.com.sg The pen, it is said, is mightier than the sword. But the piano and paintbrush can also trump enemies. This is what happens in the second and final expansion of this hit world-domination game, in which the enemies, despite
        556 words
      • Article, Illustration
        Lock icon Sid Meier’s Ace Patrol
        385 19  -  By Oo Gin Lee For an old-school gamer like me, the name Sid Meier is synonymous with God of Games. Civilization, Pirates, Railroad Tycoon and Sword Of The Samurai were just some of the games I spent my days and nights mastering while I was at
        385 words
    • Article, Illustration
      Lock icon New products
      602 20  -  Compiled by Trevor Tan BLUETOOTH HEADSET Sony Stereo Bluetooth Headset SBH20 $78 If your Bluetooth headset is refusing to pair with your smartphone, it may be time to find a new playmate. Sony’s new Stereo Bluetooth Headset SBH20 weighs all of 12g and has Near Field Communication (NFC)
      602 words
    • SME Tech
      • Article, Illustration
        Lock icon Tracking egg supplies through the cloud
        735 21  -  Japanese restaurant chain Sushi Tei cuts down on paperwork with cloud-based ordering system. reports AARON TAN aarontan@sph.com.sg Tracking egg supplies may seem like an easy task for most restaurants. But not for Sushi Tei, which has been facing snags in tracking the number of
        ST PHOTO: LIM SIN THAI  -  735 words
    • What’s in…
      • Article, Illustration
        Lock icon Elizabeth Lazan’s Razer Blade
        787 22  -  By Trevor Tan Actress Elizabeth Lazan has a rather weird nickname. Boo. Yes, the same name as the little girl in the animated movie, Monsters, Inc. It all started when she was about six years old and playing hide-and-seek with her uncle, who tried to scare
        PHOTOS: TREVOR TAN, ELIZABETH LAZAN  -  787 words
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      32 2 INSIDE First impressions of the Panasonic Lumix DMC-G6. Page 14 Actress Elizabeth Lazan reveals the contents of her Razer Blade. Page 22 SingTel adds base station to boost its network. Page 12
      32 words
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      78 3 WIN THE FUJIFILM X-E1 The Fujifilm X-E1 took home the Editor’s Choice for Best Mirrorless camera at this year’s Digital Life Awards and here is your chance to take the highly acclaimed camera home. There is one unit of the Fujifilm X-E1 up for grabs and all you have to
      78 words
    • Advertisement
      Lock icon Page 3 Advertisements Column 2
      228 3 r 5-i Did you know in one year, about US$i trillion* in intellectual property was hacked worldwide? 90% of businesses suffered some sort of computer hack over last 12 months*. It's not just big companies that are getting hacked each day. Today, cyber forensics and information security are highly sought
      228 words
Page thumbnail Page 4
Page thumbnail Page 5
  • Page 5 Advertisements
    • Advertisement
      Lock icon Page 5 Advertisements Column 1
      110 5 TAKE THE 8 lokomotoj BIG BOV XL i a m i w> i vt B\ gB j^ 0 cebo oVc f nd^ 0P P 09 lho* cOS oOOO W eS v aodP"* 65 S|$OK CHAT www.okamoto-condoms.com.sg f /okamotosingapore IN JAPAN Made to ISO standards. Quality plus Reliability. All Okamoto® condoms
      110 words
Page thumbnail Page 6 / 7
Page thumbnail Page 8 / 9
  • Page 8 / 9 Advertisements
    • Advertisement
      Lock icon Page 8 / 9 Advertisements Column 1
      399 8 / 9 it 4 Hottest New Gadgets, Great Bargains Non-Stop Thrills At Singapore’s Longest-Running IT and Consumer Electronics Show THE ret PC SHOW 2013 V. 6 9 June, 2013 Halls 5 6 Singapore Expo 12 9 pm daily FREE ADMISSION Head down to The PC Show and get the best value for
      399 words
Page thumbnail Page 10
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      251 11 AG inside orouteWe We havev° u covered Be the f irst to take your work and play SingTel is the first to bring you cutting-edge technology to let you zip around at speeds of up to 10x faster than 3G, for a seamless work and play experience. f 'h.'u i
      251 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      68 12 Industrial Professional All-In-One Touch Screen Solutions 12”/15”/17”/21” touch screen digital display Desktop/ wall mount/ kiosk stand Spill-proof industrial grade front panel Ideal for F&B, retail, exhibition, info kiosk Intuitive drag and drop interface software for easy updating by business owners Price fromSG$1480, includes hardware, software, design, training and setup Thermal
      68 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 2
      70 12 Cybersite 6-SOllltiOII A ZONE Company 97%^ i >av, ngs' FREE Trial Z0NE1511IDD Sign up to enjoy FREE* 450mins to 15 destinations! High Speed Fibre Broadband Mission Critical Class of Service ■S Free Router Installation worth $730 Waiver of Service Activation worth $883 $50 x 6 months worth $300 to be
      70 words
Page thumbnail Page 13
  • Page 13 Advertisements
    • Advertisement
      Lock icon Page 13 Advertisements Column 1
      533 13 The power of 25. Packed in the space of one. The powerful and affordable IBM System x3650 M4 Express server. To meet today’s growing demands, businesses need a highly capable server even when budgets are tight. The powerful IBM® System x3650 M4 Express® server, with the latest Intel® Xeon® processor,
      533 words
Page thumbnail Page 14 / 15
  • Page 14 / 15 Advertisements
    • Advertisement
      Lock icon Page 14 / 15 Advertisements Column 1
      368 14 / 15 V/A. Canimuniclisia2013 The 24th International Communications and Information Technology Exhibition Conference 18-21 June 2013 Basement 2, Level 1 3 Marina Bay Sands Bridging Communication Borders, Optimising Business Opportunities Asia’s Largest Info-Communications Technology Event Witness product launches and demonstration with latest key technologies LTE 4G, OTT, IPTV, mobile innovations, mobile cloud
      368 words
Page thumbnail Page 16
  • Page 16 Advertisements
    • Advertisement
      Lock icon Page 16 Advertisements Column 1
      163 16 OKI Open up your dreams Increase your productivity with the ONLY printer with AUTOMATIC *DOUBLE-sided PRINT *DOUBLE-sided COPY *DOUBLE-sided SCAN *DOUBLE-sided FAX Banner Print Feature (up to 1.3 metres) “1^ PLUS with Wireless Solutions* Terms apply Designed for Business and NOW made to suit SOHO budgets Used mainly by the
      163 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 2
      81 16 Stone Forest IT Globally Connected RSM International BYOD Implement, Manage, Secure r Stone Forest IT offers powerful solutions that help your business Implement, Manage and Secure a Bring-Your-Own-Device (BYOD) environment effectively by; Providing real-time visibility and Retaining data confidentiality control over personal devices without affecting user experience connected to corporate
      81 words
Page thumbnail Page 17
  • Page 17 Advertisements
    • Advertisement
      Lock icon Page 17 Advertisements Column 1
      290 17 ASUS recommends Windows 8. Inspiring Innovation Persistent Perfection A 1 M vj. v ASUS VivoBook TOUCH THE WORLD AT YOUR FINGERTIPS Intel® Core™i5-3317U (1.7GHzTurboto 2.6GHz, 3MB13 cache) •Windows® 8 Pro Intel HD Graphics 4000 14.0"HD LED-backlit (1366x768) Touch 4GB RAM 500GB SATA •1.75kg 5 hrs* (normal usage) 2 weeks (standby)
      290 words
Page thumbnail Page 18
Page thumbnail Page 19
Page thumbnail Page 20
Page thumbnail Page 21
Page thumbnail Page 22
Page thumbnail Page 1
  • Page 1 Advertisements
    • Advertisement
      Lock icon Page 1 Advertisements Column 1
      744 1 BUY IT-SELL IT-FIND IT ■ilfl Thelinkto great holidays Wondering where to go for your next vacation? Check out the cool travel ideas in Happy Holidays! PAGES C23 C24 Announcement CATS will be closed on Friday, May 24. Phone orders for advertisements to be published on Sat, May 25 must be
      744 words
Page thumbnail Page 2
  • Page 2 Advertisements
    • Advertisement
      Lock icon Page 2 Advertisements Column 1
      2297 2 <• < J CATS Classified. How may I help you? fax 6319-8228 e-mail cats@sph.com.sg *****89-9988 BUY IT* SELL IT* FIND IT Contact Us Mondays to Fridays: 8.30am to 6.30pm Our Rates Hotline: 1800-289-9988 Deadlines 5pm for next day's publication 6pm Friday for Sunday's publication 6.30pm Friday for Monday's publication SMS
      2,297 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 2
      252 2 ONE STOP CORPORATE Services. Accounts/ Tax/ Secretarial/ GST at good rates. Call: 6881-2918 SPECIALISING IN ACCOUNTING Co. secretary. 30 yrs experience. Cheap fastest. Florence 9730 3073. SPECIALISED IN AUDIT, tax, Accounts, BVI reg, co. sec, new co in-corpn *****081 $80++ P/MTH ACCOUNTING, Incorporation, GST, tax, secretarial svcs. *****085 SELL/ BUY
      252 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 3
      105 2 HIGH PRICE BUY in China/ S’pore gold silver coins, stamps, old notes. #01-06 Furama Hotel. *****666 BUY/WANTED Old/ New Liquor Hennessy XO Martell, whisky Gordonbleu etc Call: *****092 HIGHEST OFFER!!! FOR Old/ New Liquor wanted Martel XO Hennessy, Gordonbleu Whiskey etc/ Used spoilt elect appliance *****080 BUY IN USED LED/
      105 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 4
      382 2 i| Air-Conditioners/ Refrigerators Air-Conditioners/ Refrigerators Commercial/ Professional Italian Ovens from $900! I U-Save F B Equipment Pte Ltd 121/123 Ubi Avenue 4, Tong Xing Complex Singapore *****6/7 Fax 6841 1185 Tel: 6841 0185 www.singmahsteel.com (Fabricate/ Design/ Service/ Repair/ Export) Tf kw Work Table J SPECIAL Water Boiler S/S Chiller/ Freezer
      382 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 5
      323 2 Home Appliances/ Home Appliances/ Lighting Lighting <$cq J -3*»> •v www.sandbgroup.net Eunos Warehouse Complex (29,000 sqft) Mi[illW:1UiiMft 3 Kaki Bukit Rd 2, #01-08/09 (opp. Eunos Link Driving Centre) lT|ttT!W 10am 8.15pm Daily Bus: 25, 51,55, 87,93 94 FREE PARKING 'i'li'rjJ JJ *****853 QUALIFIED ELECT Contractor. 808 French Rd #07-169 (7/*****/5’14)
      323 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 6
      564 2 Personal Interior Design/ Interior Design/ Renovation Renovation 19 LIVING ART e I t er SSIa WWW. livingart.com.sg Blk 1 77 Toa Payoh Central #01-162 Tel: *****162 (3 Lines) Fax; 6250 4942 Blk 48 Tanglin Halt Rd #01-331 Tel: 6473 3633 (3 Lines) Fax; 6479 6595 HDB New BTO Premium Flats
      564 words
    • Advertisement
      Lock icon Page 2 Advertisements Column 7
      91 2 DIRECT HACKING/ TILING svcs, apply HDB permit for contractors. 9023-4335 DIRECT FTY PROMOTION $55 up. Kitchen/ wardrobe etc. Free quote 9027-0492 Audio/Visual 110 BUY IN USED LED/ LCD TV, Liquor, Laptop. UK, USA. Amp/spk. Sam 8182-2752 PAINTING MYSELF HDB. Condo, pte hse $200-$800 Reno big/ small projects Varnish/ partition/ cornice
      91 words
Page thumbnail Page 3
  • Page 3 Advertisements
    • Advertisement
      Lock icon Page 3 Advertisements Column 1
      2241 3 Personal® BusinessS Business OpportunitiesAgents li Business OpportunitiesAgents r Business OpportunitiesAgents Business OpportunitiesAgents Business OpportunitiesAgents Business OpportunitiesAgents Business OpportunitiesAgents W Business OpportunitiesAgents W Business OpportunitiesAgents Business OpportunitiesAgents F.ORSALESRERSONSDETERMINEDiTO.SUCCEED a a M 1 a j Let PropNex Register Your Seats Today! PropNex 1st Quarter Convention 2013 Thur30 May 2013 12pm to 6pm
      2,241 words
    • Advertisement
      Lock icon Page 3 Advertisements Column 2
      348 3 (A Wholly Owned Subsidiary of ECG Group of Companies) Co Reg No: *****1076Z Agent Lic No: L*****59F YOUR NEXT DESTINATION BE PART OF A BOUTIQUE REAL ESTATE COMPANY CALLING ALL DYNAMIC AND EXPERIENCED PROJECT RESALE AGENTS TO JOIN OUR EVER-EXPANDING GROUP 24/7 Submission Island-Wide Payment Service New Business Concept One
      348 words
Page thumbnail Page 4
Page thumbnail Page 5
  • Page 5 Advertisements
    • Advertisement
      Lock icon Page 5 Advertisements Column 1
      994 5 Nurturing the Young MATS BUY IT-SELL IT-FIND IT Hu m°n TheyhTve ?7n° ns Students 3 fexperi ence Mafhernat/cc p° 0 5tuder >t enroll^ the w °dd Chi^elL En9lish *nd ments for their s»3.po,:s»™«« .SSffij; saj^sis., a ttend to the KSS and nee *ofeS SP C fic \jk 'W>- *rSV OEUa
      994 words
Page thumbnail Page 6
  • Page 6 Advertisements
    • Advertisement
      Lock icon Page 6 Advertisements Column 1
      1021 6 Business OpportunitiesAgents Business OpportunitiesAgents r Business OpportunitiesAgents Business OpportunitiesAgents OrangeTee. TineTGhoice For Lifelong Learning He eo I Estate Training Series in our State-Of-The-Art Environment <; Commercial Industrial Realty Optimum Program < Professional Landed Optimisation Workshop o Salespersons Essential Expertise Development Strategy Our career seminar 22nd May, Wednesday, 7 pm OrangeTee
      1,021 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 2
      316 6 LARGE QTY USED warehse pallet racking, shelving, reach truck, forklift, etc. Call Calvin Koh 9681-0220 COMMERCIAL/ HSE MOVER, Disposal, storage, packing, Buy sell used furniture Dismantle/ assemble furn Protective wrapping. Free quotes/ boxes. 9320-7700 NO 1 care protection by professional mover Hse, office, disposal, storage dismantle, pack, etc. Free box/
      316 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 3
      578 6 Vehicles Classification Guide Passenger Vehicles 302 Alfa For Sale 303 Audi For Sale 305 BMW For Sale 306 Chevrolet For Sale 307 Chrysler For Sale 308 Citroen For Sale 309 Chery For Sale 310 Daihatsu For Sale 311 Ferrari For Sale 312 Fiat For Sale 313 Ford For Sale 314
      578 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 4
      221 6 Business S Vehicles 4/2010 AUDI A5 CABRIO 2.0TFSI White, 1 Owner, Agt unit. Low km. Showroom cond. Call *****883 6/2010 AUDI A6 2.0TFSI Black, 1 Owner. Agt unit, Low mileage Clean interior Tip-top Cond. 9007-6486 11/’07 AUDI R8. 1 owner. OMV $175K. Over $20K ac essories. Sell $288K (new $715K)
      221 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 5
      237 6 REPUBLIC AUTO: *****000 6/10 BMW X1 Sdrive 18I AT PML maintained. 1 owner. Hurry!! View to appreciate! REPUBLIC AUTO *****000 Apr ’10 BMW Z4 Sdrive 23I Low miles 25,000km done. Agt maintained. Call now!!! NICE NO. 3322J 7/09 BMW 318I. Black. Low mileage. 46k km only. OMV $*****. Call *****282/*****909
      237 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 6
      386 6 8/2012 BMW 535I GT. 1 Owner, Vicom Evaluated Sunroof, Low Mileage 100% loan avail .*****300 3/07 BMW 630 CI. New Tax Vicom Evaluation. 100% loan/ high trade-in avail Price neg! Call 6841-3300 11/’12 ACTIVEHYBRID 5 3.0 Omv $64k, Grey, 8k km. 1 Owner, PML Unit, Sunroof $258.8k. Jeslin *****622 4/2010
      386 words
    • Advertisement
      Lock icon Page 6 Advertisements Column 7
      288 6 ’09 740LI. F01 model. Sunroof. Agt maintained. High OMV. Call 6468-2200. 100% LOAN. 04/05 Optra 1.6A.OMV $*****. Gold. Tax 10/13. Tip-top cond. $15.9k Call *****022/ *****909 8/’07 CHEVROLET EPICA 2.0A. Full agt maintained. 1 director owned *****502 11/06 AVEO 1.4M. Sunroof. Green. Leather/ Rims. Parf $5.7K. $21.8K. 9748-2570 6/05 1
      288 words
Page thumbnail Page 7
  • Article, Illustration
    Lock icon Check before you buy
    403 7 The test drive is only one aspect of assessing a car there are other things you need to look out for. Spend some time examining the car inside-out before taking it out for a spin. Here are some things you should do: Check and check Make
    403 words
  • Page 7 Advertisements
    • Advertisement
      Lock icon Page 7 Advertisements Column 1
      300 7 V IN HOUSE Easy Loan 1.99% pa. 06 Civic 1.8A mthly$680 only. *****877 Joshua G 3/05 HONDA STREAM 2.0A MPV7-seater. Scrap$20.3K Ask $21,800. *****249. 2/’07 JAZZ 1.4M. 1 owner. OMV $14K. Accident free. low km, $31.9K. *****922 10/’07 TYPE-R 2.0M 4-dr. Accident free. 100% loan. Only $64,999. *****922 10/’18 CRV
      300 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 2
      229 7 ’04 RANGE ROVER 4.4. Well maintained with low mileage. High $101k OMV. Selling at $93k. 6468-2200. LS 600 HL V8 Hybrid Limousine 6/2011 low mileage, like new, 5 yrs warranty, OMV $141k. Ottoman seats Full features. Pursuit for perfection!!! 9818-2884 REPUBLIC AUTO *****000 Nov ’10 Lexus IS250 Agent warranty service.
      229 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 3
      202 7 HURRY! REALLY CHEAP! 11/’08 RX-8 A $65k! High Spec Facelift, Tip Cond Lady Owner *****539 REPOSSESSED 09/’06 MAZDA 3. SGL4644U. Highest offer secure. View WCEGA Plaza 1 Bukit Batok Cres. 7/’05 MAZDA 3 1.6 auto, 1 owner, 110,000km. S/rims, leather seats. *****180 2/’10 MAZDA CX7 2.3L. (A). SUV. OMV $36,717.
      202 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 4
      198 7 REPUBLIC AUTO *****000 Jan ’08 Mercedes CL500 Rare unit Low mileage. Don’t miss! Must view! Call! REPUBLIC AUTO *****000 3/11 Mercedes E300 Estate AVG 7 seater wagon. Free 1 year extended warranty. MAY’10 E250CGI. 37K kms, Rare Panoramic Roof, OMV $55.4K, C&C Maintain, 1 Owner, *****009 MERCEDES BENZ C-CLASS C180
      198 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 5
      329 7 ONE OWNER MAY/10, E250 1.8L CGI, day running light, parktronic system, full service history. 9619-1575. MUST BUY! 2013 C250 AMG Coupe! 1 owner, High AMG Specs, only 117km! Don’t Miss. Call: Ken 9824 5940 8/’96 E200 FACELIFT. New tyres. S/rims. A1 cond. Low km. Walnut interior. Digital TV. VTO. Call
      329 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 6
      241 7 1 9 m EL-31 jSrrandibamd GaniMall One of the largest Pre-owned Car Mall! Over 150 Car Showrooms Over 3800 Cars Over 580 Models Open daily 10am-8pm 210 Turf Club Road Singapore *****5 www.thegrandstand.com.sg WOW! GV INHSE loan 100% only 1.99%. Deposit $5k extra high overtrade. ’07 Lancer EX 2.0A. Low
      241 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 7
      619 7 Vehicles sss MATS BUY IT-SELL IT-FIND IT V-- 1 4 s J J □AVS LEFT MAS old ruling: Car loans can be up to 100 per cent of the purchase price. Loan could be repaid over a maximum period of 10 years, MAS new rulings: Suspended for 50 days from
      619 words
    • Advertisement
      Lock icon Page 7 Advertisements Column 8
      113 7 V INHSE FLEXI loan 1.99%. ’07 Wish 1.8A. Low mthly $688. Ideal for family use. Free 1yr insurance 6mths warranty. 2 weeks left only!! Hurry!!! 8613-6568 Louis G V INHSE @1.99% pa. G’teed loan approved ’07 vios 1.5G. mthly $488 with own workshop /lemon law and warranty provided. 15 days
      113 words
Page thumbnail Page 8
  • Page 8 Advertisements
    • Advertisement
      Lock icon Page 8 Advertisements Column 1
      193 8 **3 DAYS DELIVERY! Latest 2013 Toyota Vellfire 2.4Z c/w moonroof power dr. HP: *****717 San Hup Bee 2013 TOYOTA COROLLA 1.5 Axio. Japan made. S/rims, leather seat. HP: *****717 San Hup Bee AML #04-20 CARLINGUAL P/L *****777 2013 Toyota Mark X 2.5A 3 Yrs/ 100k km Warranty. Call now! Must
      193 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 2
      274 8 $179,800! ALPHARD 240S Full options/ accessories. Immediate. CarTimes *****111/ *****595 Kent 2013 TOYOTA ESTIMAS 2.4 Aeras .Twin MoonRoof Power back dr. High Trade in. Autopoint *****866 TOYOTA VELLFIRE 2.4 Z G Twin Moonroof. High Trade-in Available. Call Autopoint @*****866 3/07 TOYOTA MR-S 1.8M. Grey. Stock Cond. Low Km. In-Hse 100%
      274 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 3
      226 8 REPUBLIC AUTO: *****000 11/’11 Volkswagen Scirocco 1.4L. Low km. Agt warranty maintained. Don’t miss!!! REPUBLIC AUTO: NOV 2011 Scirocco 1.4A Sunroof. 3+2 yrs warranty! Keyless! Low miles! 1 owner! 9004 7093 NEW VW CC. 06/12. VGS warranty, Keyless, Navi, 14k kms, OMV $34K One Owner, *****009 Grab! 12/07 VW BEETLE
      226 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 4
      214 8 OCT 1961 SUNBEAM Alpine 1.6 Manual. Normal plate. AutoInc Sports *****123 MAR 1979 SUZUKI Samurai Zip, 800cc. Very rare! AutoInc Sports *****123 12/09 BENTLEY CONTI GTC 6.0A, black, OMV $*****6, 4900km/yr. Service regularly. Call 9663 2222 CONTINENTAL GT 6.0 Auto July 2011 White/ Black Mulliner Specs 12,800km AutoInc Sports 6338-0123
      214 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 5
      362 8 ’12 AVENTADOR LP7-00. 1 Owner. 4,300km. Agent Warranty. 6468-2200. ’07 MURCIELAGO LP640. 20,000km. Agt certified with warranty. 6468-2200 CHEAPEST IN TOWN. 05/06 White WRX. new tax Mthly S$800++. Call 9765 7171 6/’06 AVEO 1.4. Sedan. 4 drs. Gold. A1! Mthly $485. Cheap! $20K. *****238 VESAK DAY LONG WEEKEND PROMOTION BOON
      362 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 6
      291 8 Vehicles for Hire Vehicles for Hire PRIME SECTION CAR RENTAL BRAND NEW/LUXURY BMW 3 or 5 series Toyota Fortuner 2.7 \\V MercedesS/E/CClass ToyotaPrius 1.8 I Toyota Alphard/Velfire 2.4 Volvo XC60/S80 3.0 if Toyota Estima Aeras 2.4 VW Passat 1.8 SUV/MPV Chrysler Voyager 3.3 5 Honda Odyssey 2.4 Honda Stream 1.8
      291 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 7
      151 8 VEHICLE WANTED G’TEED HIGHEST OFFER for all models of luxury continental Japanese cars Trade in Available Jes *****622 TOP PRICE LORRY VAN USED CARS ANY MAKES MODELS Vincent 9763-7337 Index Credit **BEST PRICE ASSURED! LTA Appointed. Reliable Personalized Svcs. Dr-step Viewing. *****332 Khoo *CARS WANTED. CASH. LTA authorised ’60-’12. Export,
      151 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 8
      297 8 DRIVE SHAFT SPECIALIST. All model. Quality work. 32 Kaki Bukit Cres *****855 TAI THONG LEE Bank or In House Loan offers low interest rate Non-transfer/Mortgage loan Pte Commercial Vehicles 100% Loan Arrangeable Immediate Approval Sale Of Vehicle/ Insurance Provides solution for all loan 173 GEYLANG RD S(*****5) Tel: 6741-6868 INTEREST
      297 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 9
      316 8 ’97 MITSUBISHI FE657 16ft Canopy COE 4/17 New road tax. 100% inhse Loan high trade in. 6467-3300 10FT FREEZER TRUCK for sale! 12/2010 mit FB70 cabin height $87,800 Rosson Ng *****033 1/06 MITSUBISHI FK617 Box, fully done up. 100% In House Loan/ High Trade In Avail. Call now 6467-3300 ’04
      316 words
    • Advertisement
      Lock icon Page 8 Advertisements Column 10
      411 8 2/2006 PARTHER, A1 Cond, No Repairs Needed. Only $*****, Monthly $812 Full Loan. Boon *****303 COE 04/2017 LITEACE Van. excellent cond. no repairs needed. Rd tax till Sept. *****358/ *****775. MAR 06 RENAULT Kangoo Van. A1 cond. mileage @76 km. Rd tax Oct. $16.8k. *****358/ *****775. 2003 TOYOTA HIACE Van
      411 words
Page thumbnail Page 9
  • Page 9 Advertisements
    • Advertisement
      Lock icon Page 9 Advertisements Column 1
      727 9 Properties Classification Guide Residential Properties for Sale Landed Homes for Sale 402 D01 -08 City South-West 403 D09-10 Orchard/Tanglin/ Holland 404 Dll &21 Newton/BtTimah/dementi 405 D12-14 Balestier/ MacPherson/ Geylang 406 D15-16 East Coast 407 D17-18 Changi/ Pasir Ris 408 D19-20 Serangoon/Thomson 409 D22-24 West 410 D25-28 North 411 Mixed Districts
      727 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 2
      218 9 ROY ANG *****575. OPEN Hse! Sentosa Waterway Bunglw. Land fr 6600 sqft. Fr $15.xM. Serious seller! OPEN 2-6PM BY Lionel Loo Sentosa Tropical Villa. 7800/ 8400 sqft, Grand! *****592/ *****062 DTZ NEW! BARTLEY RIDGE. 1rm fr $635K. 2rms fr $895K, 3rms fr $1.1m. 4 rms fr $1.79m. Tang 9009-9930 NEW!
      218 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 3
      183 9 OTANIC *****SF NEW Leedon 21-51k sf land Nassim 50k sf Hilltop Bishopsgate *****sf. Rare Only $2xxx psf. *****777 B ONE TREE HILL 2584/4860 sf. 2.5 sty semi-d. 5+1. Pool FH. ION Orchard/ Tanglin Mall. Elevated. Park 2 cars. Wilson Lim 8183-5132 BEDMAR AND SHI 5600sf work of art 4 large
      183 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 4
      213 9 TANGLIN MODERN BLACK White taste newly re-built GCB *****/*****sf on hill top ready to move in. Grab RARE! FIRST AVE 3-sty semi-d. F’hold. 2200/ 3100 sqft. 4+1 ensuite. Tenanted 10/2014. $6.18M. *****228 CHATSWORTH VICINITY. *****sqft. Good Fengshui Best Value For Your Castle $25m. Pauline 9108-3203 HENRY PK HIGH grd privacy.
      213 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 5
      282 9 D10 GCB. $26.XM. Land *****/11k sf. Big frontage Best PLOT!!! *****480 RL www.landedhome.com.sg MEGA SHELFORD SEMI-D 8350 sqft. 1km to RPGS/ Nanyang. Potential to detach. Rare! Call 6100 8000 IMMACULATE! TOH TUCK Corner terr 2110 sf, 3+1 rm $3.xm only. View to appreciate Call Victor *****333 3 INTER-TERR SIDE by
      282 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 6
      249 9 TOH TUCK CORNER terr. Reno. Move-in. Spacious rms ensuite. Future MRT/ sch/ amenities. Kat 9852-7531 GORGEOUS LAND Watten Estate. Approx 6400 sf. Rebuild to your ideal home Raven Chua, 9388 2333 LUXURY BUNGLW @BARKER 6700/8000 sf. Park 4 cars Pool. Excellent location. Raven Chua, 9388 2333 MODERN SEMI-D Hillcrest. 2.5
      249 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 7
      385 9 SEMI-D DAIRY Farm area 2-sty, 3902 4000 sf. 5+1 loft, reno, future MRT. Carol Phui *****365 PN D11 LA SUISSE 3-storey terr Built-up area 3,300 sqft 4+1+1 rms. Call *****828 GENTLE RD CLUSTER corner terr 4230sf 3½sty. 6 bdrm Tenanted FH *****592 HB ELEVATED BUNGLW. MUSWELL Hill. N/S facing, 10.5K
      385 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 8
      260 9 DUNBAR WALK NEW Semi-D 4040/ 7000 sf, 6+1. Pool. Frankel Ave New Semi-D 2675/ 4200 sf. 5+1 Pool. Jln Pari Dedap new Semi-D 2764/ 5000 sf 6+1 $5.88M Boscombe Rd Semi-D 5+1 2675/4200sf Pool $5.28M Sennett Vicinity Semi-D 5+1. 3300/ 4600 sf $5.8M RARE CORNER SEMI-D Lucky Cres. 3157/ 3300
      260 words
    • Advertisement
      Lock icon Page 9 Advertisements Column 9
      431 9 Properties D15 2.5STY UNIQUE Resort style Terr Dafne St 1318/ 2800sf FH. Like New! MRT $2.XM only. Best buy!! BRING LUGGAGE! Siglap terrace 1940/5000sf. 3.xm Marzuki terr 1800/3600sf 5+1.$3.xmJames*****795 RAMSGATE 6100SF $10.xm Mayfield 4300/7000 8.xm Brand new PooleRd 4800/ 5000sf. $8.xm. *****795 FH KATONG 3STY semi-D. 4436/ 3800sf. 6 rooms.
      431 words
Page thumbnail Page 10
  • Page 10 Advertisements
    • Advertisement
      Lock icon Page 10 Advertisements Column 1
      277 10 BEST VALUE BUNGLW in a Great Location. Parkstone area. 4800/ 5000sf. Pool Lift. Call 6100 8000 now RARE RAMSGATE BUNGLW 6100sqft, 6 rms, Exclusive neighbourhood. Fantastic plot Call Jimmy *****989 $2.XM ONLY TEMBELING Rd Inter-terr 1420 sqft, 3+1, Suits A+A. Going soon! call RealStar 6100 8000 now CONVENIENT KATONG AREA
      277 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 2
      267 10 VERY RARE HOME near CHIJ St. Nicolas, 2 sty semi-d facing park 3300/ 4000 sf. Gary 9111 7777 Visit: homeguruasia.com RARE TROPICAL ESCAPE 3 sty corner terr 2850/ 4000 sf near Ai Tong/ future MRT. Gary 9111 7777 Visit: homeguruasia.com OPEN HSE 1-5PM. 1, Rosyth Terr Rare Tudor revival. 3-sty
      267 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 3
      275 10 D19 LEITH RD 999yrs 3sty Semi-d 3400/2148sf 4+1+ study. Renovated/spacious Carol *****066 SPZ **ECG LANDED COLLECTION 2½ sty Semi-D S’goon Gdn 61 Conway Grove. Lap pool Ask $4.35M neg *****680 **ECG LANDED COLLECTION 2½ sty Semi-D S’goon Gdn 7 Berwick Drive. 999 yrs. Ask $3.8M neg. 9738 1680 THOMSON INTER
      275 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 4
      255 10 ALMOST NEW! TERR S’goon Gdn. 1860/3000 sf. F/reno with lap pool. Ask $3.2M. Eugene 9005-5710 SEMI-D@ JLN LEBAN 3400/ 4500sf 6+1 Beautiful $5m. Terr Serangoon Gdn 2300 sf 4rm$3.48m. *****396 NEW LAUNCH! SHOWFLAT open 10am. 27 F’hold cluster units, mins MRT. 3 generation home. Fr $700 psf LATEST Charlton Road,
      255 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 5
      288 10 3 STY INTER-TERR roof terr 99yr build-up 2895/ 1719sf. no noon sun potenti al for upgrader. *****845 ECG DYNAMIC ALLIANCE Chestnut Semi-D 5800 sf Future MRT Railway Mall. View 2-4pm. 9766 7772 ECG DYNAMIC ALLIANCE Burgundy Rise 3 Sty Semi d 2323/3250sqft. $2.xM Move In! 2-4pm: *****772 BURGUNDY SEMI D
      288 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 6
      300 10 SELETAR 3YRS SEMI-D Face S. 2½sty 3072/4300sf. 5+1 all ensuite. Mins Greenwich Nicole Chia 9380 3803 CORNER TERR KELULUT Hill 2598/3139 sqft. 2sty+attic. Koi pond lover and bird keeper paradise! Nice hse! PINEWOOD GR. LAND 2056/ 3800sf inter terr. 3 mins main rd/ quiet. 5 squarish rm/high ceiling $2.1xm neg
      300 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 7
      437 10 SPRINGSIDE 3-STY CORNER f’hold $11xx psf, 3725 sf, huge 4 Ensuite, view anytime. DTZ lilian *****353 Emily Aung Invest, Sales and Lease Call: 9692 3323 CB Richard Ellis Corals at Keppel Bay Luxury Urban Marina Living Visit to be in Awe of Waterfront Living! Top Notch Quality furnishing #05-08 Penthse
      437 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 8
      341 10 CORALS@KEPPEL BAY! NEW 1rm fr 624sf, $1.31mil up 2rm fr 883sf, $1.82mil up 3rm fr 1281sf, $2.29mil up 4rm fr 2583sf, $6.43mil up ***SAIL, MARINA BAY Res Sail, 657/ 893sf $2100+ 2/3/4 rm Bayview $2600+ Marina Bay 1/ 2/ 3/ 4 rms $2600psf+ Call 8551 8623 REFLECTIONS KEPPEL Bay. 2
      341 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 9
      304 10 RIVER PLACE 4-RM, 2066sf Mid flr, full facilities, pool view, Clarke Quay. $3.3M neg. KC Yong 9186-8833 THE SAIL FULL bay view. 3+study. 1800sf. Mid flr. Rare Spacious layout. Sold vacant. $5.xM. $28xx psf. OCEANFRONT SENTOSA 3 bdrms, 1711 sf. Low flr. Marina view. Selling with tenancy. Hurry! Call now
      304 words
    • Advertisement
      Lock icon Page 10 Advertisements Column 10
      403 10 D02 THE BEACON for sale. 2 units. 1485 sf. 3+1 bdrm. Nice patio. High flr. MRT. Call Sylvester 9116 6688 LUMIERE SHENTON Way. 1/ 2 rms 506/ 624/ 969 sf. Few units fr $1.05M up. Tenanted. Bonnie *****003 THE BERTH Sentosa 2 rm 1173 sf. Boat berthing. Face waterway. Attractive
      403 words
Page thumbnail Page 11
  • Page 11 Advertisements
    • Advertisement
      Lock icon Page 11 Advertisements Column 1
      689 11 #ffl D09-10 Orchard/ Tanqlin/ Holland IRID09-10 Orchard/ jM Tanqlin/ Holland Tanqlin/Holland Tanqlin/Holland Pte Apts for Sale PteApts for Sale HALLMARK RESIDENCES DISTRICT 10 Ewe Boon Road Special Discount i o% 7% s%! •2,2+Study, 3 4-bedroom I Penthouses •969 sqft to 3,681 sqft •Within 1 km to ACS (Barker Road) SCGS
      689 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 2
      305 11 MT SOPHIA FH. Lowest 1st Dual Key Concept. Fr $1.3xm. Double income for 1 price! Mins walk to MRT. For VVIP priority, call now. FIRE SALE! FH 1 bdrm penthse. 1195 sf with roof terr, jacuzzi. High ceiling. MRT. 3 yrs old. S$1550 psf. Sole Agt Betty 9380 2737 SKYLINE
      305 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 3
      285 11 FIRE SALES! MUST sell! Parvis 3 bdrm Selling with $8K tenancy. Last offer, $1940 psf. Ivan 9875-1882 **THE SOLITAIRE 3670SQFT Duplex Penthouse. Privacy Yet Exclusive! Panoramic View! Very Serious Seller! FR $1.105M! D.10 FH condo. 4 mins MRT, 2 reputable pri sch within 1km. Good returns. David 9792-7527 LIV ON
      285 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 4
      279 11 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual Keys. Steven Chin *****393 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual Keys. Call Zulfadli *****707 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT.
      279 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 5
      294 11 URBAN RESORT! TOP soon! 3/ 4-rm/ Penthse. Special disc fr $24XX psf. Shpg/ MRT. Call for viewing appt. LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM! Call Peter Yao 9117-1673 LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM!
      294 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 6
      304 11 LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM! Call Jason Ong 9800-1807 PENTHOUSE $5.414M JUST TOP. 999 yrs Wharf Res #23 floor Gorgeous view. *****025 û LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM! Call Steve Chin 9633-4333
      304 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 7
      273 11 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual Keys. Charles Chong *****136 VISIONCREST. 2 BEDROOM 904/1001 sqft. 5 mins MRT Orchard Road shopping. Freehold. PK Soh 6100 1131 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual
      273 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 8
      273 11 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual Keys. Call Ernest Lim *****187 NATHAN SUITES. PTE lift. Freehold. Developer sales. 3-rm, 1776 sqft fr $3.4xM. 4 rm, 2034 sqft fr $4.3xm MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT.
      273 words
    • Advertisement
      Lock icon Page 11 Advertisements Column 9
      274 11 LUCKY PLAZA ORCHARD. Best Buy! 1550sf. High Flr. Reno. 4bdrms. $1939 psf! Ang Wee Chee *****599 LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM! Call Ben Ng 9726-9210 DIRECT DEVELOPER SALE Killiney 118 F’hold 1/2 bdrm Limited units left. Price fr $21xxpsf. Hurry! *****919
      274 words
Page thumbnail Page 12
  • Page 12 Advertisements
    • Advertisement
      Lock icon Page 12 Advertisements Column 1
      392 12 LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM! Call Ellen 9246-0603 MOUNT SOPHIA FR $1.3xM! Liv On Sophia. 5 mins walk to MRT. 2 bdrm Dual Keys. William Chew *****256 LIV ON SOPHIA. FH. SOHO concept. 2bdrm. Mins walk to MRT Shpg. Fr $1.3xM!
      392 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 2
      347 12 Dll &21 Newton/ BtTimah/Clementi Pte Apts for Sale Dll &21 Newton/ BtTimah/Clementi Pte Apts for Sale Dll &21 Newton/ feUff BtTimah/Clementi Pte Apts for Sale Dll &21 Newton/ HU BtTimah/Clementi Pte Apts for Sale Dll &21 Newton/ BtTimah/Clementi Pte Apts for Sale Dll &21 Newton/ BtTimah/Clementi Pte Apts for Sale
      347 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 3
      168 12 ***HIGH OAK 1207SQFT 3+1 Open Hse Sun 5~7pm. 1km Pei Hwa PPS. Resort living! Grd flr. A1 Decor! Move-in! NEW LIST! BLOSSOMVALE. 2rm, 840sf. Rare. 999 yrs. Future MRT. Best investment in Bt Timah. $1.35M. PAVILION 11. 3 sty penthse. 4219 sqft. 4+1. Panoramic view! #31. Quick sale $1322 psf.Grab!
      168 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 4
      193 12 SOUTHAVEN II. 2+1. 958 sf FH. Pool view, resort feel Amenities, good sch. mkt. Must view! Goh *****633 HILLCREST VILLA CLUSTER Hse 3154 sf. 5+1. 1km RGPS NYPS. Designer decor. $3.45M. Eddie 9111 5283 D11 FH SETIA Res 3348 sf, 4+1 ensuite.Rare exclusive unit with pte lift. High flr. Beautiful!
      193 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 5
      125 12 5% RENTAL G’TEED for 2 yr Extra disc! Call to discuss Urban Heritage @Balestier FH. Low maintenance fee! $1200 psf only! 9738 1680 ST MICHAEL REGENCY 4+1 Penthse, 2917 sqft, bright, windy. Mins to MRT CBD. Freehold. Ask $10XX psf MAISONS BRADDELL, Woodleigh MRT, NEX, schools. 1/2/3rm/penthse. Star buy prices.
      125 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 6
      205 12 MAISONS NEW FREEHOLD Braddell Hgt. Near MRT, Int’l Sch, NEX. 1/ 2/ 3-rm/ Penthse. Star Buy Promo! MAISONS NEW FREEHOLD Near MRT, Int’l Sch, NEX. 1/ 2/ 3-rm/ Penthse. Star Buy Promo! Sukanto *****263 MAISONS NEW FREEHOLD Near MRT, Int’l Sch, NEX. 1/ 2/ 3-rm/ Penthse. Star Buy Promo! Patrick
      205 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 7
      150 12 WATERBANK@DAKOTA MRT 1+study, 635 sf, $1.1M neg 2bdrm, 883 sf, $1.28m neg 3bdrm, 1130-1259sf, $1.7xm EIGHT RIVERSUITES. MINS to MRT/ Orchard/ Marina Bay and CBD. Breathtaking Design. 3 rms from $1.1xM PARC HAVEN. RARE 1-bdrm 688 sqft. $1M. High flr. No sun. Move-in. Exclusive! Florence Soh 9815 0831 PRICE REDUCED!
      150 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 8
      317 12 SANT RITZ. A Class of its own. Unique row house, penthse, 3/2bdrms, next to MRT, near city Good invest SANT RITZ. AN exciting city fringe devt next to Potong Pasir MRT. High rental yield. Call Pram *****155 VACANZA EAST. FH. TOP soon. 3 bdrm. $1.32M VTO 1023 sqft. Mid flr.
      317 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 9
      271 12 ***THE SHORE TOP 2013. 592 sqft. 1-Rm. Best stack 872 sqft. 2-Rm. Pool view 1055 sqft 2-Rm Best facing 1389 sqft. 4-Rm. High floor MEYERISE DEVELOPER SALE Freehold from $16XX psf!! 2bdrm 883sqft, $1.791m. 3bdrm 1270sqft, $2.313m. 4bdrm 1819 sqft, $2.965m. ST PATRICK’S RESIDENCES. Pre-TOP Promo 2/ 3/ 4/ 5rm,
      271 words
    • Advertisement
      Lock icon Page 12 Advertisements Column 10
      259 12 SIGLAP STRATA HOMES F’hold Semi-D Terraces Min Amenities/ F&B/ Shpg Call 8180-1228 elAine@SV THE MAKENA 3+1, 1615 sqft. Rare facing. Full sea view living hall rms. High flr. F’hold. Jay Ong 9146-6635 SILVERSEA TOP SOON!! Full sea view. 3 bdrms. 1657 sf. High flr. Best stack. Hurry! Sam Chua 9693-0481
      259 words
Page thumbnail Page 13
  • Page 13 Advertisements
    • Advertisement
      Lock icon Page 13 Advertisements Column 1
      350 13 COSTA DEL SOL New Listing 3+1, 1346sf. Partial seaview $100K Below Valuation www.CityLuxeHome.com SEAFRONT ON MEYER 3rms 1604 sqf high flr beautiful MBS view. Sell attractive price Audrey *****855 AALTO. PANORAMIC SEA view. 1959/ 1550 sf. 4/3+1 High flr. FH. $2400 psf neg 9856-2008 Mary Vu PN HURRY! MUST SELL
      350 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 2
      293 13 LOYANG VALLEY. 1981 sf. 3bdrm. Like landed countryside living lifestyle. VTO. Raymond *****368 $7XX PSF ELIAS G r e e n 1528 sqft. Dual Entrance 3rm. Very Spacious. Bright Pool view. 9655 3596 LIVIA 2+1, 915 sf. High flr. Balconies. Reno. No west sun. F/facilities. Near MRT. TOP ’11. Betty
      293 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 3
      282 13 BELOW VALUE! CHANGI Rise 3rms 1130sf. High flr. Spacious. Unblock. MRT. $1.xM. Visit: www.ericyeo.net BELOW VALUE! NV Res 3rm. 1109 sf. High flr. Unblock. MRT. Almost sold! $1.xM. Visit: www.ericyeo.net DAHLIA PARK. F’HOLD 1646 sf. Top flr. Unblock. 3+1+1. High ceiling. Move in. $1.68M neg. 8399-2441 CK SAVANNAH CONDO LOVELY
      282 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 4
      277 13 EVERGREEN PK 1249SF, 3+utility, f/ facilities/ tennis ct, no noon sun. MRT/ shpg mall. *****622 Ong SUNGLADE 3-BDRM. 1163SF High Floor, Pool Facing. Urgent and Serious Seller Call/SMS Nick 9644 4854 THE QUARTZ 1066 sf, 3+1. Move-in. Nice city park view. 9747-3330 Derek Ng LAUREL TREE $5XXK up. 1/ 1+1/
      277 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 5
      354 13 BedokHDB Apts for Sale BedokHDB Apts for Sale BedokHDB Apts for Sale BedokHDB Apts for Sale BedokHDB Apts for Sale BedokHDB Apts for Sale CATS Classified GUIDE TO HDB TOWNS CLASS CODES SEMBAWANG WOODLANDS YISHUN BUY IT-SELL IT-FIND IT CHOA CHU KANG KAf I BUKIT PANJANG PUNGGOL SENGKANG JURONG WEST
      354 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 6
      209 13 BULLION PARK FH Condo 1)1259 sqft 3+1. Pool view Well keep Quiet Price right 2)1873sqft.Panoramic view 3+1+family Call 9009-1339 NORTHOAKS/ WOODSVALE 3+1. #03 #05 #09, #11, #13 $890k+ 1238-1313sqft MRT Call *****689 John Tsang NORTHOAKS/ WOODSVALE $890K+. 3+1 #01/ 06/ 08. 4+1. Pool view. Near Mrt. Tony Kwek *****270 MEADOWS
      209 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 7
      184 13 THE ESTUARY (BRAND New) 2 bedrooms. From $1.1xM+ 3 bedrooms. From $1.4xM+ Just TOP! Fred *****002 ESTUARY YISHUN, TOP! 1/2/3/4 rms, 592-1528 sf. Reservoir/Pool view. F/ facilities. Khatib MRT. neg. 3NG BLK 110. ALL races. 4NG 543 Val Chinese filled 4NG 213 Val. Chinese filled. 4NG Blk 414 Val. All
      184 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 8
      180 13 3’NG’ BLK 570 AMK. High flr, Walk to MRT/ Hub. Unblocked, valued. Move-in. View now! Ally 8112-2213 3’NG’ BLK 571, Mid flr. Mins walk to MRT/ Hub/ park/ schs. All races, orig cond. Lift, can contra, Immed. 4’NG’ 344/ 3’NG’+1 419. Upgraded paid, w/balcony. Corner. Lift. High flr. Opp AMK
      180 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 9
      210 13 BLK 762 BEDOK Reservoir 4rm Condo layout. High flr. No West sun. Ask $580K. VTO. Jasmine 8388 0009 DBSS BELVIA TOP Nov 2014 3/ 5 rm. No COV. 1st timer CPF grant/ 2nd timer no levy. Chinese quota filled MUST SELL! 4’S’ 134 Bedok Res. Unblocked. Next to corner. Amenities.
      210 words
    • Advertisement
      Lock icon Page 13 Advertisements Column 10
      204 13 2 MKT+ MRT. Blk 34, Rare! 3 big rm Utility. Lift serves 2 units. Windy. Ask $448K. Jenny *****777 3’I’ 502 BEDOK N St 3. Bare unit. 58sqm. New list! Good location. Near mkt/ sch. 8688-2810 Corliss 3’NG’ BLK 709 Bedok Res. Corner. 82 sqm. Mid/ lift level. Well kept.
      204 words
Page thumbnail Page 14
  • Page 14 Advertisements
    • Advertisement
      Lock icon Page 14 Advertisements Column 1
      365 14 5I BISHAN BLK 163 high/ lift flr, unblock, no noon sun. Near market. Open Hse on sat by appt. Nik *****939 4’S’ BLK 146. Lift level, unblock, simple move in. Val $430K. All races *****718 FALL IN LOVE again! 366 EM High Flr.Unblock Bright Windy. Near MRT. Serious Seller. Stephen
      365 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 2
      336 14 143 JLN BT Merah. Corner. 5’I’ 117 sqm. bright, windy, unblock. Well kept. Near amenities. Value $590k. 3’I’ CORNER BLK 42 Telok Blangah High flr. Greenery Well kept. Privacy. Valued. Jason 9066-2626 OT 4A JLN MEMBINA 26B Corner, 85 sqm, $723K ono. 5mins to MRT. View by appt only. Chris
      336 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 3
      309 14 CENTRAL AREA JLN Kukoh 1+1. 54 sqm. #18. Nice view. North East. $339K. View to offer. Lisa Lim *****060 4’A’ BLK 12 Farrer Pk. Corner. High flr. Unblocked. Mins to MRT City Sq. No noon sun. Stella 8383-1118 4’A’ BLK 671A Klang Lane. High flr. F/aircon. Well kept. Lift level.
      309 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 4
      284 14 RARE! 3’NG’ 377 Clementi new reno. Near good sch/ Mall/ amenities. All races. Val$390K. Goh *****263. 376 CLEMENTI AVE 4, 3’NG’ Modified. Corner. 81 sqm. MRT. Chinese ratio filled. Val $430K. Serious Seller. 3A CLEMENTI MRT. 82sqm Lift level, big rm, no noon Sun, high flr. Can erect 1 extra
      284 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 5
      285 14 4A BLK 984A Buangkok Link. Reno. Corner. Lift level. All races. PR eiligble 5’I’ Blk 985B Buangkok Cres High flr. Reno. Corner All races. PR eligible. Shop 3-RM BLK 108. Top flr, corner, lift landing, double height ceiling, designer decor. Val $3xxK+ $120K. Wendeline Goh 9108 1234 BLK 166 4’A’
      285 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 6
      382 14 4’A’ HOUGANG 165 #02. Reno, well kept. Near amenities. Val $415K COV $5K up. Saz *****284 PN 4S CORNER 632. 100% move-in. Near amenities. All races/ PR. Val $400K $20K up. Saz *****714 PN 5-RM BLK 956. High flr/ lift level. 116 sqm. Hougang Pri/ 1 Mall. Valued. All races/
      382 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 7
      333 14 RARE! 3-RM adjoin (4bdrms 2 utility) 130 sqm. Boon Lay Blk 211. High flr. Can contra. Eddie 9108 3115 PN RARE 5’I’ CORNER 865 High flr. Huge 4 bdrms 126 sqm. Val $445K Ask $460K. Sat Open House 2-3pm by appt SERIOUS SELLER! EM Blk 410. High flr. 150 sqm.
      333 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 8
      329 14 21 ST GEORGE’S 5’I’ High flr. Superb View. MRT. Val. All races/ PR. Grab Fast! Shirley Luar 9387-7290 3NG ST GEORGE’S high flr. Unblock. Boon Keng MRT No noon sun. Renovated Simply. *****909 Wendy 3-RM +1 BLK 11 Upp Boon Keng. MRT. Unblock. Amenities Potential gain!! Sat 2-4pm. Call/ sms
      329 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 9
      353 14 4A BLK 216 Nicely reno. 106sqm High flr. Val $425k VTO. Near amenities. Can contra. Andy 9027-5979 4’A’ BLK 453 Pasir Ris 4 bdrms. Rare 114sqm. Top flr. Unblock. No noon sun. 100% move in. Amenities. 5’I’ 1313 sf, corner/ dr-to-dr. Pasir Ris MRT/ Elias Mall. Val $510K. All races
      353 words
    • Advertisement
      Lock icon Page 14 Advertisements Column 10
      314 14 4’A’ PUNGGOL FIELD 196D Corner unit. High flr. Value $462K. VTO. View by appt Douglas Chua 8338-1878 5-RM CORNER D&B 135 Edgedale plains. No noon sun. Nice deco. Val $515k. Neg! Derence 9765-4332 PN PROPERTY Elites Div. Nice, Exec apt. Blk 184. High flr. Eric. 9818-1929 5’I’ BLK 176A Reno.
      314 words
Page thumbnail Page 15
  • Page 15 Advertisements
    • Advertisement
      Lock icon Page 15 Advertisements Column 1
      301 15 4’A’ 317. HIGH floor. Bright, Breezy Nice! Near mall. Broken marble. Valued. All races. Grace 9852 6147 4A 469 ADMIRALTY Dr. Superb cond. High flr. Windy 102 sqm. Marble flr. Val $440k. 1st cheque secured 4A BLK 466D. Priced to sell #08. 90 sqm. Corner. Face NS. Amenities. Val: $440K.
      301 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 2
      304 15 SPR ELIGIBLE 5I Point Blk 261A, corner, beside Sengkang MRT. Sch/Park. Nicely Reno, 100% Move-in. $10K COV ONLY 4’A’ 272C #06 corner, unblock view, urgent, must sell, hurry! Call Damien *****929 OT 135 RIVERVALE ST. 141 sqm. High flr, unblock. Move-in cond. Ask $645K. Value $595K. Lau CK *****393 142
      304 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 3
      305 15 $570K ONLY 4’A’ Blk 272A corner, low COV, value buy big master, move in cond. Call Damien *****929 OT 5’I’ 307 TOP flr. Good as new! Unblocked. LRT/ sch/ coffee shop. Val $525K. Valerie *****148 ERA 5’I’ 314A ANCHORVALE #03 Designer’s decor. 110 sqm. Valued. Near MRT/ Nan Chiau/ Mall/
      305 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 4
      402 15 LOW COV! CORNER Blk 369 4’A’ Privacy. Amenities/ MRT. All races/ PRs. Val: $427K. Erlinda 9009-7607 MRT 5’I’ SIMEI 253. Corner. High floor. 122 sqm. Door N.E. Val. $610K. Well kept. VTO! *****228 Florence MUST SELL! 5’I’ Tampines 254 Dr to dr Mid flr, simple Windy. Unblock view. Mins MRT.
      402 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 5
      339 15 3’I’ CORNER BLK 178 Toa Payoh Ctrl. #03. Lift level. 2 mins to MRT. Can contra. Vacant. Rajan *****037 3RM BLK 225 Lor 8 Movein Renovated, Unblock Windy Hawker, Sheng Siong, CTE, Bus/ MRT. Val $311K. VTO. 4RM BLK 141 Toa Payoh Lor 2. Corridor end. High flr. MRT amenities.
      339 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 6
      409 15 4’A’ BLK 690, $12K Closed! Corner, 9yrs old, lift level, garden view, quiet, Sch/ MRT/ Amenities. Must Sell! 4’A’ BLK 754, 102sqm. #08 Simple unit with svc balcony. All races M’sian PR. Valued $400K. Selling only 5’I’ BLK 321 Woodlands St 32. 127 sqm, lift flr. Corner, balcony, spacious, mins
      409 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 7
      355 15 OPEN HSE SUN 2-3pm, Appt 3S Blk 722 High, Marble Flr Unblock, All Race, Val 317K www.RayzProperty.com RARE! JUMBO BLK 666, 1763 sf. Dual key. Val $675K, spacious, bright, quiet, park/ mkt/ school. 3’A’ BLK 806 Yishun Near Khatib MRT. Original Cond Lift Level, Upgrading Paid. All Races PR welcome
      355 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 8
      482 15 DALLA VALE/ HORIZON Gdn. Expat’s Choice! Resort living. Pool/ facilities. 3-sty/ 5-rm Only $6.xK. NEW LIST! COOL Nice Corner Terr YCk Gdn. f/furn MRT/ St Nicholas/ market $6k+ Cul-de-sac *****139 JANSEN ROAD 3-STY inter terrace. 1840 3025 sqft. 5+1 rms. Available July ’13 Call Phelia Yeo *****138 ASHWOOD GR, 4+1
      482 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 9
      348 15 **DUNEARN ROAD. NEWLY rebuilt. 6500/ 9500 sqft. 4-levels, pool. Opp MRT, Botanic Gardens $27K. 9863-5635/ 9727-2996 CORONATION GCB *****/ 7600 sqft. 4+1+ pool gdn Renovated. Quiet. Immed. $20K neg. *****602 Eliza LORNIE RD SEMI-DETACHED 5+1. Approx 4100/4500sf. Reno. Pool, gdn. Immed. Patrick *****344 HRE 2-STOREY CORNER TERR Jalan Lada Puteh.
      348 words
    • Advertisement
      Lock icon Page 15 Advertisements Column 10
      378 15 BUNGLW HOLLAND Grove pool. 5+1. Full alarm system. Fantastic hse P/furn, $16.5K. David 9487-9600 SPACIOUS CLUSTER Bunglw 8500 sf built-in. 6 rms ensuite. 3-sty basement. Park 3 cars.Peh *****857 HOLLAND GROVE. (MRT). Delightful tropical 5+1+1. Inviting patio/ pool $21K Connection *****799 BUNGLW AT TYERSALL Rd/ Gallop vicinity. 2-sty with basement.
      378 words
Page thumbnail Page 16
  • Page 16 Advertisements
    • Advertisement
      Lock icon Page 16 Advertisements Column 1
      396 16 JURONG KECHIL 1½ sty semi-d. Tastefully reno. 3+ loft. $7K. Fance *****697 GREENLEAF RISE 2½-STY Semi-D. Spacious 6+1. Well kept $12.5k *****707K.teh 3-STY GREENWOOD CRES. Inter-Terr 5+1. New. $8K P/furn. Eileen 9007 1033 KISMIS AVE. 2 sty Bunglw. 5+1 bdrms. Pte Pool. Near amenities. $13K. *****130 D.11 MERRYN TERR. 4+1+loft
      396 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 2
      457 16 PULASAN RD 2-STY Corner Terr, move-in 4 bdrm $6k+ Bunglw Joo Chiat Lane. 7500 sf. $1xK. 9852 9055 KEW GREEN CORNER Townhse. 4800sf, 4+1 +roof terr /jacuzzi. Pool/ gym. Bright, reno $7.xk Jean *****888 BOSCOMBE RD. 3-STY SemiD. 4800 sf. Fully reno. 5+1. Near amenities. $11.8K neg Immed. Owner *****708
      457 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 3
      426 16 462 462 sea ca E Ik Kl] Unrivalled oceanfront living on Sentosa Cove I Direct ocean views from balconies and bedrooms 3 bdrms: 2,164 2,336 sail. 4 bdrms 4,133 sq.ft 4,069 sq.ft m level 4 harm Developer s Exclusive Leasing Agent HALCYON REAL ESTATE PTE LTD JALCYOjN Willy Hoe Q
      426 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 4
      389 16 FARRER PK MRT. Residences Somme. Studio approx 500sf. Avail immed $2.8K. Ryan *****099 DOVER PARKVIEW, 2-RM, 970 sqft, fully renovated furnish. Unblocked view. $4K. Chris *****020 RIVER PLACE RARE penthse 1356 sf, 2 bdrm. Breath taking view with jacuzzi. $7.2K. Alexis 9876-8870 THE SAIL 689 sqft Studio cum study. F/furn.
      389 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 5
      375 16 ICON IMMED 1-BDRM apt. Tg Pagar MRT. F/furn. Good natural lightings. Well main -tained. Ben 8368-7398 PARK WEST CONDO 2 rms. 872 sf. Spacious. Walk up Nice unit. Clementi MRT. Immed. Jenny 9109-8702 MARINA BAY RESIDENCES, 1,981 sqft, Beautiful Bay View, 3+1 Balcony. Call Christine Foo *****093 EMERALD GDN 33
      375 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 6
      503 16 KELANTAN 1 RM 1 hall. Mini Apt. Furn. New reno. Cook 9187-3259 Landlord DOVER PARKVIEW 2RM F/ furn. Nice cond. Near MRT avail June. *****991 Lily THE SAIL 2-BDRM 936 sf. Bay view. F/furn. Avail. Immed. Joanne *****157 QUEENS 3+1. 1194 sqft. High flr. Unblocked. Furn. MRT. Immed. Agt 9666-9666
      503 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 7
      519 16 0K I D09-10 Orchard/ Tanqlin/Holland ®D09-10 Orchard/ Tanqlin/Holland Tanqlin/Holland Tanqlin/ Holland Tanqlin/Holland Pte Apts for Rent Pte Apts for Rent Pte Apts for Rent D09-10 Orchard/ Tanqlin/ Holland 9 Far East Organization INSPIRING BETTER LIVES Grange 70/80 at Grange Road Minutes to ISS International School, Overseas Family School and Orchard
      519 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 8
      154 16 **BOTANIK RARE GRD flr 3+1. Facing lush greenery 1680sf, Beautiful. Immed. $8K. SM Chia *****500 CAVENAGH COURT. 3+1RMS. 1819 Sqft. Prime Location Avail immediately. Call! Visit www.*****399.com D.10 ROYALVILLE Bt Timah Duplex reno unit 2100sf 3+1 p/furn,spacious cosy breezy. 9475-1341. SOMMERVILLE PK 4+1 3068 sf,p/furn,new reno, immed Farrer MRT. Amenities.
      154 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 9
      189 16 MOHD SULTAN 800 sqft Charming conserved 1-bed isabelredrup.com/ir22.php$4.2k. *****055. Susan 1+1 RM 904 sf. New Killiney 118. P/f/ furn. Quality finishes. Convenient $5.6k. 9685 9959 Kate 3BEDRM ENSUITE. 1604 sf. Cuscaden Royale. Tip top cond. P/furn. High floor, $6.3k. 9685 9959 Kate CORNWALL GARDEN. 635SF 1-rm. Quiet facing. Resort style.
      189 words
    • Advertisement
      Lock icon Page 16 Advertisements Column 10
      303 16 MIRAGE TWR. STUDIO. 1-rm. F/furn. Very high flr. Opp Great World. Mins Orchard Immed. *****-448 Sim TANGLIN HILL CONDO 4+1 duplex. Gdn face pool. New reno. 3200 sf. Immed. Quiet. $12k up. 9061-7448 Sim D’DALVEY 3-RM 1270 sf. P/ furn Pte exclusive. Pool/ gym. Botanic Gdn MRT Immed. Sean 9800-3608
      303 words
Page thumbnail Page 17
  • Page 17 Advertisements
    • Advertisement
      Lock icon Page 17 Advertisements Column 1
      421 17 D10 TESSARINA 4+1 1604 sqft, P/Furn, pool view, no noon sun,amenities,immed $6xxx. Dess 9005-1618 COSMOPOLITAN 1324SF 3+1 +balcony.High flr,MBS view Near amenities Orchard. $7.xK. Jean 9628-1888 RS ***$5.5K/ $6K LEONIE Hill 2/3rm+ maid’s balcony 1141/1386 sf 5 units Exclusive agt Simon 9666 1441 VILLAGE TWR, PANORAMIC view of Holland from
      421 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 2
      532 17 CLIVEDEN 4RM 2824SQFT Ardmore II 4rm 2023 sqft. Trilight 2bdrm 1109 sqft. Park Natura 3rm 2314sqft. THE TRIZON 1593 sf. 3+1. High flr. Furn. F/ facilities. Walking distance to MRT. Adeline 9026-0890 PN THE PIER STUDIO 750sqft Beautiful Cond Big Balcony Clarke Quay MRT. Jun. $4.8K. Marco *****099 GRANGE RES.
      532 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 3
      546 17 D.10 90 HOLLAND MRT. Spacious. 2+1 rm. Facilities. $4.5K Agt *****259 SCOTTS HIGHPARK 1744 sf Nice 3+1. Pool/ gym/ MRT Immed $8K.MRC *****327 QUINTERRA 4RMS HIGH Flr. Unblock view. $7k. Immed. Hurry! *****567 Christina D.10 BALMORAL HGTS. 2+1, approx 936sf. Furn. MRT/ greenery. Lena *****488 THE PIER Robertson 2rm 1098sqft
      546 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 4
      364 17 ROBIN ROAD Brand New Condominium off Stevens Road 2 1 Bedrooms 1,400 sq ft $6,600 Spacious Layout Full Facilities Near Orchard Road 3 1 Bedrooms 1,830 sq ft $8,800 Flexible Lease Term Private Lift Lobby Unblock greenery view CALL9656 9562 TERRENE BT Timah 1873 sf. 3+1. Newly TOP. Penthse.Serene.Beautiful. Must
      364 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 5
      450 17 $3.1K ONLY! CASCADIA 1rm Cozy home. Balcony 581sf P/furn. Tip top. Good schs. Alex www.*****676.com MEADOW LODGE, CHARMING 4+1, Walk to Amenities, 1,410 sqft, Full Commission Christine Foo *****093 BROOKVALE GROUND FLR. Mais. Quite Serene. 3 bdrms, 2,300 sf. Well reno. P/furn. Call *****957 Ivan AMANINDA 1 BDRM 614 sf.
      450 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 6
      356 17 CHEAPER THAN HDB! Jln Gembira 1+2 small rms. P/furn. Eateries. Immed. $1.9K. Wendy 8686-2768 CASA MEYA@ POTONG Pasir MRT. 2rms F/Furn unblock, Balcony High flr A1 cond. Pool/gym Cerina *****301 2 MINS TO Paya Lebar MRT Shpg Mall. 3+1. Paya Lebar Res. High flr. P/Furn Good view. Foo-*****488 RITZ MANSION
      356 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 7
      395 17 DUNMAN VIEW 2RM $3.6k Casa Merah 1238sf $4.5k Esta 3+Study Pool $5.8k One Amber 3rm Nice $5.1k One Amber 4rm #1x $6k Seaview 4rm #1x $6.5k Parkway Man 1819sf $4.5k Amber Point 3+1 #19 $5.5k Seaview 2809sf #2x $11.8k STRATFORD CT 3 rm 1733 sf Hawaii Twr. 4 rm 4500
      395 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 8
      337 17 CHANGI GREEN 2+1. 1055 sf Big hall. Windy. Bright. Near amenities. Vacant. Act fast! *****889 Lau SIGLAP V, 603SF, 1+1 bdrm, brand new. F/furn, cosy. Eateries, amenities, beach. Immed. Imm 9026-5340 AXIS SIGLAP 2 bdrms penthse. 1711 sqft. Designer decor. F/furn. $4999 neg. Vacant. *****999 Jim OPTIMA. 1-BDRM. F/FURN. Designer
      337 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 9
      523 17 COSTA DEL SOL 1227 sf. 3 bdrms. Face greenery. P/ furn. Internet newspaper Immed. 9615-6013 Serene THE COTZ 1 bdrm. 452 sf. Along Telok Kurau Rd. F/ furn. Pool. Quiet. $2.6K. Immed. Call Willy 9022-1131 TANAMERA CREST. 2-RM. Furnished. Peaceful. Tanah Merah MRT, shops. Avail end May. Rosie 9386-6122 MANDARIN
      523 words
    • Advertisement
      Lock icon Page 17 Advertisements Column 10
      298 17 SEAVIEW POINT, AMBER Rd. 1400 sf. 3+1 Balcony. Bright. Sea view!! *****153 EASTERN LAGOON I. 1055 sf. 2+ balcony. Reno. P/furn. Immed. Jas 9857-8230 **RIVIERA RES. 3-RM. Pool view. Balcony. Upp East Coast/F&B Andy *****964 PINEHURST 3+1 RM, $3.3K. Riviera Res 3+1, pool $4.3K Kelvin 9060 5181 Landz **AMBER RES
      298 words
Page thumbnail Page 18
  • Page 18 Advertisements
    • Advertisement
      Lock icon Page 18 Advertisements Column 1
      390 18 MELVILLE PK 2-RM. 1076 sf. Ground flr. P/furn. Move-in cond. Mins to MRT. Immed. Julie Cheak 9066-5833 CARISSA PARK 1141 sf, 3+1 p/ furn, new paint, high flr, f/ condo facilities, immed. Cosy. Johnson *****838 FERRARIA PARK, 3+STUDY, 1324 sf. Reno. No west sun. P/furn. Quiet Bright. Immed. Esther 9028
      390 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 2
      321 18 PARK NATURA. LIKE New! 3-rm, spacious. Convenient. Near ammenities. Avail Mid Jul. Aidah Lim 9107-8126 PARC OASIS 3-BDRM 1378 sf F/furn Chinese Gdn MRT High flr. Nice view. Immed Also sale *****040 Kelvin PARC OASIS 2+1, 1076sqft, high flr, lake view, bright, windy, opp Chinese Garden Avail Mid Jun. Ask
      321 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 3
      417 18 PARC OASIS 3-RM $3.7K. The Mayfair 3-rm $3.7K. Yew Mei Green 3+study $3.2K. Kelvin 9060 5181 THE JADE. 4-BDRM 2 attach. High flr. 1616 sf, Airy Bright. P/furn. 2 mins MRT. Immed. Mary 9380 5683 CASPIAN, 3+1, HIGH flr, 1238sf, pool view, unfurn/ p/fully furn, Avail. Mid May, MRT. Jas
      417 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 4
      371 18 $2.6K BULLION PARK 2 rms 807 Sqft. High floor. Nice view. Furn. Well kept. Clean. Vivian 9007-0696 WOODSVALE 3+1 F/FURN. Windy. Short/ Long term. Avail 5/6. MRT. Chetan 8484 2979/ 9131 7950 NORTHOAKS/ WOODSVALE, 3+1. Full/ P /furn $2.8K+. Avail immed/ June/ July. Tony Kwek 9765-4270 BRAND NEW ESTUARY. $3K
      371 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 5
      432 18 ASTER RM. F/FURN aircon in Terr. opp Chai Chee Techno Pk/ Bedok MRT. *****392 M JOO CHIAT RD Common rm, clean bright incl utility, broadband, furniture, air con. Immed. JL *****006 NO OWNER MASTER Common rm Orchard. F/furn. Aircon. Wifi. All races. Walk to MRT/Mall Ally 8112-2213 COMMON/ MASTER RMS:
      432 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 6
      432 18 PASIR RIS. MASTER rm. Blk 241. Furn. Near Amenities. Available immed. Neg. Call Jenny 9688 0819. HOLLAND AVE. COMMON rm for rent. Only single lady/ students. Convenient. Bus stop shops. 9072 2411 COMMON RMS: 106 Yishun, 141 Sengkang, 560 Pasir Ris, 236 S’goon. Furn, near MRT, amenities. Immed. BLK 12
      432 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 7
      468 18 5-RM 204B COMPASSVALE Dr. Beautiful, spacious unit,Neat tidy, mins to MRT. L.Leong 8688-9833 ERA 3+1 BLK 881 Woodlands F/furn, aircon. Mkt/ school 1st July. All races. 8 pax $2.7k. Ramesh 9696-5373 BLK 165 4’A’ Reno. Low flr, near Simei MRT. Prefer family. P/furn. Available Immed. Wong 8201-3466 AMK 207, 4’A’.
      468 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 8
      454 18 NEAR AMENITIES NEW LIST! 2+1. 103 Bukit Purmei. P/furn. Well-kept. Prefer professional. Avail 1 Jun. neg *****713 Cindy 3’I’ HOLLAND BLK 2. Mid flr Nice Decor Fully Furn. Opp MRT/ Holland Village. $2.xK. Michelle *****668 3-RM GHIM MOH Blk 21. Fully furnished. Well kept. Near MRT. Avail. Immed. Jolena Tan
      454 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 9
      582 18 5-RM TAMPINES 230B. Corner High flr, near MRT/ sch/ shpg/ amenities. F/ furn. 9756-7716 James NEAR MRT 119 Aljunied Ave 2+1, all races. 900sf. 2 air cons, attach toilet, painted $2.5K neg. Nick *****377 771 BEDOK RES View 5-rm, 1237sf. Corner, High flr, Good cond. $2.7K. Partial/ f/furn. Bonnie 9782
      582 words
    • Advertisement
      Lock icon Page 18 Advertisements Column 10
      452 18 EA BLK 287A Jurong E, 143 sqm, Reno. High flr. Greenery. For expat family. www .wuitoon.com 9040-9596 652A JURONG W. Approved 3+1. 110 sqm. Aircon F/furn Well kept. MRT/ amenities/ NTU. $2.7K. Jac *****100 *DOVER 2+1 F/FURN. 2 airc on. New reno. Clean, cosy. MRT.Immediate *****747 2+1 CLEMENTI 335. Reno,
      452 words
Page thumbnail Page 19
  • Page 19 Advertisements
    • Advertisement
      Lock icon Page 19 Advertisements Column 1
      840 19 Cap/taLand »Hi-Tech Biz Space Good Location TECHNOPARK@CHAI CHEE 179 53,000 sq ft Within walking distance to Bedok MRT Stn Call: 8113 9192 9796 6485 Factory Space For Lease Tuas 8,700sq.ft. to 33,000sq.ft. URA B2 Usage 5-Ton Overhead Cranes High ceiling Ample Electrical Loading 24-Hour Security Fitted Office Space In-House Canteen
      840 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 2
      372 19 ENTERPRISE HUB. B2 fty. No GST. 3111 9000 sf. Ceiling hgts 8m. $6.xK up Eileen Wong 8383-7858 EUNOS AVE 8A. B1 Factory/ Office. Light Ind. Bare cond, 2400 sf $1.90 psf. Near PIE. Chris 8201-1886 FTY/ SHOWROOM Yishun 2766sf. Ground flr. Good frontage. Full Glass Panel Fitted. Ronnie 9615-5922 #01
      372 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 3
      410 19 HENDERSON BLDG/ IND. B1 space. 1238 sf. Carpeted, aircon Sale/ Rent. Others 550-4400sf. 9733 3368 PIONEER CTR #06-XX. B2 hgt 6mtr column free. MRT Immed. $2.00 psf neg. David Cheang *****199 PN TCH TOH Guan, 1900 sqft beautiful fitted office, bldg with corporate image, $3.9k. Stan *****184 PIONEER LOT Benoi
      410 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 4
      592 19 fW Factory/lndustrial 5H Factory/lndustrial fUf Space for Sale Space for Sale Far East Organization INSPIRING BETTER LIVES 5-Storey Corporate Building with Basement Carpark at Kaki Bukit Fully tenanted with immediate rental income Total floor area of about 56,000 sq ft Cargo lifts and loading bays available No additional buyer's stamp
      592 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 5
      384 19 JOO KOON. JTC Fty. MRT. Built in 22,000/ 20,000 sf. Bal 18+ yrs. Val/Sell $4.8M *****968 Mike. Sole Agt. EUNOS TECHNOLINK 3735sf 20’ container doorstep, bal 43 yrs. Opp. Ubi MRT. Ask $1.4Xm. Gary 9851 4866 FIRE SALES! PIONEER Ctr. B2. Just TOP. #02. 1485 sf. $350 psf only. 6%
      384 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 6
      403 19 S9 S’GOON North 58 yrs Leasehold, 8% 2% +3% disc. 1701 to 15,421 sqft. No Void. Ramp-up Flatted. KAPO FTY. RARE F’hold 2400 sf; First Ctr 1313 sf, 60 yrs. Tenanted till Apr/ Jul 2014. Sivan *****046 CORNER JTC S-STY fty with mezzanine Kampong Ubi. 3046 sqft. Also for rent.
      403 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 7
      297 19 EXCALIBUR CTR Ubi Cres #01. 4521 sqft. $2.68M. Terence Tan 9147-0138 BT.BATOK ENTERPRISE CTR, 3500 sqft Wcega Plaza, 2500 sqft. 9832 3197 Loke TUAS AVE/ SUNGEI Kadut *****/ ***** sf. Standalone fty $6.5M. *****101 CORNER TERR FTY/ office at Kallang. High ceiling. ***** sqft. *****078 Tay KAKI BUKIT 3-STY terr
      297 words
    • Advertisement
      Lock icon Page 19 Advertisements Column 8
      566 19 CECIL COURT 138 CECIL STREET Office space 812-1,825 sqft Bare units Prestigious address Near Raffles MRT Basement carpark Enquiries, Call owner *****380 *****161 Capital Tower 1249/ 8630/ ***** sqft 6 Battery Rd 1755/ 2390/ 5000/ 6000/ ***** sqft Robinson 77 8902/ ***** sf DBS Twr 2 4542/ ***** sf Samsung
      566 words
Page thumbnail Page 20
  • Page 20 Advertisements
    • Advertisement
      Lock icon Page 20 Advertisements Column 1
      294 20 Medical Suites for Lease Mins to Gleneagles and Mt Elizabeth hospitals •Over 100 top medical and healthcare specialists •Located in Tanglin and Holland areas •Radiology, Pharmacy and Diagnostic Labs For enquiries, please call 6434 9808/6434 9832/6434 9800 camden.com.sg TUNG CENTRE Excellent Seaview Next to Raffles Place MRT Station 1,001 sq
      294 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 2
      349 20 1) MILLENIA TWR, 2 flrs of 17,007 sf, scenic, avail Sep. 2) 1 Phillip, 2874 sf, pte lift, immed. Dave 9456 7444 9000SF WHOLE FLR plate. Smaller unit avail. F/fitted. Short lease avail. Near MRT. Sean 8366-5660. MOHD SULTAN 800 sqft Charming conserved office isabelredrup.com/ir22.php$4.2k. *****055. Susan **LOW IN Lavender.
      349 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 3
      532 20 D’CENTENNIAL SIMS Lane 5 mins walk Aljunied MRT. 1206 sqft, move in cond. Tomas 9090-4004 PN FAR EAST SHPG Centre 355 /1744 sf. Guthrie Bldg. 1915 sf. Duplex. Near MRT. $neg Immed. Mandy 9797-7189 WOODLANDS OFFICE. Near MRT. Whole half office, low rental. Call *****213 û $2.9K. MACTECH BLDG Kallang
      532 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 4
      532 20 KEWALRAM HOUSE BUKIT Merah. 2200 up to 9128 sqft. Renovated. Fitted. Exclusive floor. 9631-6939 THE ARCADE RAFFLES Pl. Fully Fitted, Renovated, Furnished Unit, 240 363 sf. Suits 6-9 pax *****654 STARHUB CTR, NEXT Centre point 710, 1270, 1647, 1959, 2540, 5080 to 10,000 sf. Immed. David 9451 -1821 INT’L PLAZA
      532 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 5
      341 20 W ffisf” I69 s?" I 69 fflsS"" FAR EAST ORCHARD ILJ LIMITED i NOVgi Premier Medical Suites For Sale Located in Novena medical hub and surrounded by reputable medical institutions Linked to Novena MRT station, Square 2 and Oasia Hotel Singapore Medical suites from 667 sq ft and are suitable
      341 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 6
      388 20 A’POSH YISHUN Ave 6. 1600 sf $750 psf. 1688 sf #03 $460 psf. 1281 sf #05 $470 psf. Henry *****188 PAYA LEBAR SQ. Grade A office. Next to MRT. 99 yrs. Column free. Fr 484 sf. Call Vodka 9777 6908 INT’L PLAZA 936/ 2357 sf $2400 psf. High flr, sea
      388 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 7
      285 20 BISHAN HDB 350SF approx Dual frontage/suit fashion, IT accessories/ takeaway F&B. Colliers 9728 6566 F&B/RETAIL SPACE, S’GOON Gdn. 140-624 sqft. Ideal for luxury goods/ services Ample parking. 6532-1163 BEAUTY, HAIR Slimming for takeover Bt Batok. 2400sf. Ask $90K. Rent $3600. 9238-7855 Joseph FERNWOOD TOWERS SHOP. 350sf.Grd flr.Water supply. Free carpark.
      285 words
    • Advertisement
      Lock icon Page 20 Advertisements Column 8
      216 20 WHEELOCK PLACE Prime retail units for lease from 3,700sf Suitable for Beauty/ Spa/ Aesthetic/ Selected Medical Services Tel: 6733 1188 6731 1892 GYMNASTIC HALL (8 Metres Column-Free) Also Suitable for MartialArt, Yoga Pilates, Dance Studio etc Dimension: 28mx14m Strategically Located in Future Jurong Gateway Surrounded by Residences Attractive Rent Free
      216 words
Page thumbnail Page 21
  • Page 21 Advertisements
    • Advertisement
      Lock icon Page 21 Advertisements Column 1
      1399 21 ®Mr I® Mr I® Mr I® Mr iiiil! Antral THE CENTRAL Above Clarke Quay MRT Station Average shopper traffic over 1 million month City centre residences PMETs tourists Unit sizes from 194 sq ft to 3,003 sq ft Suitable for fashion apparel lifestyle book restaurant home furnishing and accessories PROPERTIES
      1,399 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 2
      471 21 HDB SHOPHSES For Auction Blk 4 Toa Payoh Lor 7 Eating hse to minimart,2357 sf, tenanted, ample parking Telok Blangah Cres Blk 8 1388 sf, next to Giant/mkt. Bt Batok St 21 Blk 213 1658 sf, tenanted, MRT Sims Place Blk 47. 1324 sf, tenanted, near MRT/ mkt Knight Frank
      471 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 3
      312 21 BLK 465 NORTH Bridge Rd. Approx 640sf. Near Beach Rd/ ICA. Walk to Lavender MRT. #01. Tenanted. Rare. TANGLIN SHPG CTR. FH. 2 adjoining units 678sf. Tenanted. Best buy! Genuine offer! Shermeen 9815 1636 UBI 1485 SQFT. 2 sty. Good traffic. Vacant possession Jurong East 1798sqft. 2sty MRT Call *****040
      312 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 4
      335 21 F&B Retail Space West Coast (next to Circle Line MRT) LAST FEW UNITS! *790 to 5,038 square feet Near West Coast Highway Ground Floor Units Available Equipped with Grease Trap Exhaust Flexible Operating Hours Ample Parking Space 24 Hour Security CALL6578 9966 S’GOON RD 2-STY shophse. Land 3255 sqft. Flr
      335 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 5
      420 21 WATERLOO ST. 7200 sf. Next to MRT! Best facing. Suit medical/ education/ spa. neg Lynn *****966 $2.XK PSF! PENINSULA Plaza Shpg 333/ 380/ 1184/ 1485 sf 999 yrs, tenanted MRT *****769 Eastview JLN BESAR SHOPHSE 3 sty Land 1434 sf. Built in 3800 sqft Tenanted. Good rental yield 3%. Keith
      420 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 6
      325 21 SMALL INDUSTRIAL UNITS Eunos(near MRT Bus Stop) Kallang FREE 1 MONTH TRIAL!!* *400 800 1,100 sq. ft. Flexible Lease Term Immediate Move In Ancillary Showcase Area Office 24-HourAccess Security Ample Parking/Loading Next to Foodcourt Agents welcome CALL6578 9966 537 BEDOK N. 4088 sf. 7+1 p/fitted coffeeshop. Attractive incl of outdoor
      325 words
    • Advertisement
      Lock icon Page 21 Advertisements Column 7
      271 21 Mechanical Workshop 13,000 sqft Open yard 90,000 sqft Warehouse 25,000 sqft 24hrs security. 9138 3281 OPP WOODLANDS MRT. *****00 sqft Light clean ind building. Free parking. Covered loading unloading for 20ft or 40ft container. 24hr CCTV security. neg. Call Owner *****938 RAMP-UP WAREHSE/ FTY Loyang Cresc, 45-ft container trailers Accessible
      271 words
Page thumbnail Page 22
  • Page 22 Advertisements
    • Advertisement
      Lock icon Page 22 Advertisements Column 1
      342 22 GRD FLR. B1 Warehouse Genting Lane. 6652 sf with 2 loading bay. Ample parking. FH. Ong TL *****377 NOVELTY BIZ CTR. Ramp-up Warehse. Many units. TOP 3rd qtr ’13. FH. Amenities. Ali Gafoor 9006-8001 (PN) CITILINK PASIR Panjang Rare! FH. 1884 sf. F/reno. Vacant/ tenanted. MRT. $1.6M. SK Tan 9844-7778
      342 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 2
      180 22 400% ROI. ICONIC High-end Condo, Astaka, JB city ctr. 100% int’l lots. Sales office open,register interest now! ISKANDAR RES @MEDINI. Mins Legoland, Puteri Harbour, Edu City. 129 yr LH. Low Cost Invest fr $1xxK THE RUMA 5-STAR hotel res KLCC. F’hold. 5 yrs 6% nett yield returns for hotel Angie
      180 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 3
      840 22 Free Easy Travel Free Easy Travel Free Easy Travel Free Easy Travel Club Med WHERE HAPPINESS MEANS THE WORLD May Jun School Holiday Special Travel Period: 01 May 30 June 2013 (Taxes: $150 $360) Terms conditions apply 4D3N Club Med Bintan fr$580 4D3N Club Med Cherating fr$750 4D3N Club Med
      840 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 4
      169 22 cruises, com.sg x;/STAR CRUISES\ Y (TW feKwiAyrotz S\^oujAaM: ;es ises isei Fares shown are per person, based on double occupancy. Taxes from SS188 S$357 are subject to change. Other terms conditions apply. MISA TRAVEL 6538-1098 #03 5 1 3 0*&pore r 05°531 St CALL NEW SHAN Travel for Air ticket
      169 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 5
      565 22 Properties Travel Short Getaways Short Getaways Short Getaways Short Getaways B?irHLN0lMQM ENTS music' 005 a nd peitorr 0000 5 Hte10 ,teCe°WC inerted Mos. 27tti Macau Nove tt*>ei pvpTrXENCE ilriilB rVaiiJPt 3D2N Macau Experience i[ Package Includes: Free one full day city tour to Penha Hill, A-Ma Temple, Kum Lam Status,
      565 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 6
      115 22 SI Overseas Hotels Overseas Hotels Resorts |||f Resorts resorts, com. sg Club Med MAY JUNE SPECIAL 4D3N Bintan fr. S$640 Inc membership fees 3D2N Pullman Danang Beach Resort fr.S$ 615 3D2N Banyan Tree Samui fr.S$ 1389 4D3N Anantara Dhigu Maldives fr.S$ 2346 8D6N Anahita The Resort, Mauritius fr.S$ 3064 All
      115 words
    • Advertisement
      Lock icon Page 22 Advertisements Column 7
      45 22 BEST AIRFARE TO HK Japan, China, USA/ Jakarta Bkk/ Taiwan/ London. Visa application/Hotel T&C. Kim Travel *****042 TA309 FOR SPECIAL AIRFARES Please call Focal Travel at *****033 TA 883 3D2N HONG KONG f&e fr $338 tax $145. Wingo Travel *****337 TA1175 Continued On Page C24
      45 words
Page thumbnail Page 23
  • Article, Illustration
    Lock icon Journey to new lands
    520 23  -  Half the year has whizzed past us! Now's a good time to give yourself a pat on the back for having made it to the halfway mark and take a well-deserved break. Refresh and recharge yourself by exploring new places and savouring new experiences. Happy Written
    520 words
  • Page 23 Advertisements
    • Advertisement
      Lock icon Page 23 Advertisements Column 1
      1457 23 dynasty travel Grab Your Mid-year Holiday Deals Now! r o' Book Online Anytime Anywhere! nmilTP11I1T11 riirnu www.dynastytravel.com.sg REWARD POINTS WITH EVERY PURCHASE! 8D Gold Coast, Tangalooma Theme Park Resort (AG0D8) Brisbane Moreton Island Gold Coast Fr$2088* 8D6N Melbourne Sydney Indulgence (AMSD8) I Fr$2148* Confirmed Dep: Jun 4,7,8,14,15 Dep: Jun 22
      1,457 words
    • Advertisement
      Lock icon Page 23 Advertisements Column 2
      2 23 Special Focus <®>
      2 words
Page thumbnail Page 24
  • Page 24 Advertisements
    • Advertisement
      Lock icon Page 24 Advertisements Column 1
      1416 24 WATS BUY IT-SELL IT* FIND IT HAPPY iik sfkk Chan's\ Unusual Vacations, Agfl World Unique ExperiencesBgJ|||| fcr FUN-NATIC YOU! MUSLIM TOURS ENGLISH SPEAKING 8D Korea Saranghaeyo! B°| e a 5p *l? Romantic Petite France Nami Island ko* ea Immerse in Korean 1RGANIZATION Cultural Village Jeju Taeseum Safari Museum, Seojikoji Ice
      1,416 words
    • Advertisement
      Lock icon Page 24 Advertisements Column 2
      837 24 fth We look forward to serving you better! All prices are subjected to associated taxes surcharges correct at time of print subject to change fr$323 to $405. TAIWAN $1088 Taiwan 8V RHYTHM Of TAIWAN (tpss) HSIN CH U/N ANTOU/TAICH U NG/ i TAINAN/KAOHSIUNG/TAITUNG/ HUALIEN/TAIPEI v'The most popular round island tour
      837 words
    • Advertisement
      Lock icon Page 24 Advertisements Column 3
      127 24 Travel Two weeks before you leave... Check your suitcase or travel clothes (winter coats, for example) for damage that may have gone unnoticed since the last trip.They may need replacing. Make sure your passport has at least six months of validity remaining. Confirm with your travel agents and embassies that
      127 words
Page thumbnail Page 25
  • Page 25 Advertisements
    • Advertisement
      Lock icon Page 25 Advertisements Column 1
      3257 25 Tours Tours Tours Tours Tours Tours Tours Tours Tours Tours m SUPER TRAVELS 'S' AC fiK i(S Ilill JHPr 13/15D Eastern Europe Russia 75% -100% Meals/ Hot American Breakfast Hungarian Goulash Dinner/Saltmine/Auschwitz/German Beer Dinner Highlights: Heidelberg/Budapest/Slovakia/Krakow/ Warsaw/Poznan/Dresden/Berlin/Prague/Plzen/Vienna Cfm Dep: May 31 (6 seats left) Jun 5(4 seats left),7(4 seats left),
      3,257 words
Page thumbnail Page 26
  • Page 26 Advertisements
    • Advertisement
      Lock icon Page 26 Advertisements Column 1
      937 26 BANGKOK 4/5D Chiangmai/Chiangrai/ Maesai/Golden Triangle/ fr $299 Mix Hill Tribes Daily Departure (Jun 5,12,19,26)* amaz/he THAILAND Always Amazes You www.tourismthailand.org/sg {J c lOjg )THAI 4 $i69 Daily Departure I stay at Glow Pratunam or similar complimentary airport transfer Taxes: $191-$200 Welcome "Khantoke Dinner" show in Lanna style White Temple Maerim
      937 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 2
      362 26 Primary Tuition @QUALITY Teachers MOE Master Teacher MOE Senior Teacher MOE HODs NIE-trained Teachers @PROVEN track record Asia Pacific Brands Award Recipient High of A* and A @SMALL class size Call 6899 8134 now www.truelearning.com.sg GRADE BUILDER J C Tuition classes Mid-term test preparation for GP Econ Hist Geo Math
      362 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 3
      387 26 Travel*7“ Notices Jf RJC SECRETS REVEALED! Coached personally by exRJC lecturers next to Marymount MRT, opp RJC. Maths/Physics Chemistry Call *****444 /www.R3.sg 2013 NEW SCHEDULES reowned school Teachers Orchard/Bt Batok/ Bedok/ Tampines/ Bishan. Sec/ JC all subjects. Caraven *****731/ 8188 8555. IP SCH PROG: Eng Lang Art, Lit, Integrated Humanities
      387 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 4
      355 26 PHYSICS, MATHS, CHEM coaching Bukit Batok by Ex-Sch Teacher. 9786 0411 **MATHS SPECIALIST: ADD, Elementary, IP, GEP Maths, H2, H3 Maths. 9878-5857 RJC/ HCI/ VJC Teacher for A/O/IP/IB Math, Phys, Bio, Chem, GP,Econ. 6286-6561 JC/ SEC MATHS Classes at T Payoh 10yrs+ experience Limited spaces 9790 8700 MRS HONG CHINESE
      355 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 5
      681 26 THE SINGAPORE ISLAND COUNTRY CLUB TENDER NOTICE NOTICE OF INVITATION TO TENDER FOR ADDITIONS AND ALTERATIONWORKSTOBUKITCLUBHOUSEATBUKITLOCATION FOR THE SINGAPORE ISLAND COUNTRY CLUB (SICC). Interested firms that meet the following tender criteria are now invited to submit tender for the Additions and Alteration Works to Bukit Clubhouse (Men’s Changing Room) at
      681 words
    • Advertisement
      Lock icon Page 26 Advertisements Column 6
      168 26 APPLICATION FOR REPLACEMENT SUBSIDIARY STRATA CERTIFICATE OF TITLE THE LAND TITLES ACT AND THE LAND TITLES (STRATA) ACT NOTICE Pursuant to Section 43 of the Land Titles Act, an Application will be made to the Registrar of Titles within the next fourteen (14) days from the date hereof by BOH
      168 words
Page thumbnail Page 27
  • Page 27 Advertisements
    • Advertisement
      Lock icon Page 27 Advertisements Column 1
      782 27 >4 WATS NOTICES BUY IT*SELL IT• FIND IT Toll free 1800-289-8822 Email notices@sph.com.sg www.cats.com.sg/notices TERMINATION OF STRATA SUBDIVISION LAND TITLES (STRATA) ACT NOTICE NOTICE is hereby given pursuant to section 81 of the Land Titles (Strata) Act that the Management Corporation Strata Title Plan No. 226 (having its registered office
      782 words
    • Advertisement
      Lock icon Page 27 Advertisements Column 2
      164 27 TENDER NOTICE Singapore Arts School Ltd. (Co Reg. No *****0775C), the company that manages the School of the Arts, Singapore, governed by the Ministry of Culture, Communication and Youth (MCCY) invites proposals for the following TENDER NO SAS/OP/2013/002/T DESCRIPTION Tender for Canteen Stall at Zubir Said Campus TYPE OF STALL
      164 words
    • Advertisement
      Lock icon Page 27 Advertisements Column 3
      47 27 AMERICAN EMBASSY SINGAPORE The American Embassy invites companies to quote for short-term rental of vehicles (chauff eur selfdrive) for sedans, vans, buses, trucks. The contract will be for one base year with one option year. Send email to stellah@state.gov to obtain copy of the Request for Quotation.
      47 words
    • Advertisement
      Lock icon Page 27 Advertisements Column 4
      1714 27 TENDER NOTICE Singapore Press Holdings Limited invites proposals for a Pre-Qualifi cation tender for the supply of Internet connectivity for SPH. The proposal shall include managed services to protect against Internet attacks of various natures. Eligibility Criteria for Tenderer: 1. Have a Sales and Technical support offi ce in Singapore.
      1,714 words
Page thumbnail Page 28
  • Page 28 Advertisements
    • Advertisement
      Lock icon Page 28 Advertisements Column 1
      2334 28 WATS RECRUIT Executive Appointments 1800-289-8822 Classified Jobs 1800-289-9988 www.cats.com.sg/recruit Professionals/ Professionals/ Professionals/ Professionals/ Executives Executives Executives Executives ROCKWOOC F I H E S A F E INSULATION The ROCKWOOL Group of Companies is the world's largest producer of stone wool insulation. Founded in 1909 and headquartered in Denmark, today the
      2,334 words
    • Advertisement
      Lock icon Page 28 Advertisements Column 2
      92 28 EX-AGENTS/ BANKERS/ EXPERIENCED SALES PERSONNEL Offering 150% (of Avg past year income) Attractive income scheme fr $1.5k-$4k/mth Exam fees admin support provided Interested please call *****600/ *****044 or email to:virtus.careersg@ gmail.com MARKETING PROMOTERS Health/ Beauty prod Basic salary $1.5k-$3k High Commission passive income assured We train you to understand nutrition.
      92 words
    • Advertisement
      Lock icon Page 28 Advertisements Column 3
      367 28 Office System Furniture Supplierrequires SALES EXECUTIVE ÊAchieve monthly sales targets ÊSelf-motivated and result oriented ÊAble to start work in a short notice ÊSingaporean SPR only È9777 0321 FINANCIAL SERVICES CONSULTANT 21 years old and above S¡¯porean SPRs Diploma 4 ’O’ levels Attractive income scheme fr $1.5k-$4k/mth Exam fees Admin support
      367 words
Page thumbnail Page 29
  • Page 29 Advertisements
    • Advertisement
      Lock icon Page 29 Advertisements Column 1
      425 29 INDOOR SHOWROOM SALES $1300 (Neg) Commission Incentive. No experience needed. Call 6884 5755 (11 am 5 pm) Mr Ong DR TO DR Agt Attractive bonus incentive travelling opportunites. No prior experience. S’porean/ SPR only. SMS now: 8651 2774 DIRECT SALES SELLING couple Keychain, Dr-To-Dr Streets. Cash comm $50 -$300/day. S’porean/ORD/
      425 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 2
      561 29 Retail Sales Eelf Retail Sales EC1V Retail Sales If you’re passionate about customer service and have a distinct sense of style, WE WANT YOU SALES SUPERVISORS Reporting to the Department Manager, you will be managing the department so as to meet the department's sales target and to maintain a high
      561 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 3
      318 29 RECEPTIONIST REQUIRED PLEASE. Submit your CV to embassy of Zimbabwe. Email repofzimbabwe@ singnet.com.sg TELEMARKETEERS Fix appt, no sales involved Bilingual No experience needed Able to start work immed Mon to Fri 1pm 9pm Sat 12.30pm 7pm Earn $3K above S’porean SPR only Call Iris *****829 EARN APPROX $4K/MTH Telemarketing bank
      318 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 4
      190 29 CALL CTR, CUSTOMER svc, PC skills. Call *****587/ *****520/ *****898 SEEKING CUSTOMER SVC. urgently!Part/full-time. Pls sms name, age: 9613-1054 Polo Restaurant Pte Ltd 80 Mount Pleasant Rd requires 1. ASST MANAGER 2. SERVICE CREWS 3. COOKS *Good career prospects Only S’porean SPR We offer attractive salary benefits Call *****995 Email
      190 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 5
      417 29 TAKUMI RESTAURANTS KEPPEL BAY Full Time Service Crew/ Waiter Full Time Cook Senior Cook Requirements: Minimum 1 to 2 years’ experience in restaurant or F&B industries Friendly, service oriented and pleasant personality Able to perform shift duty; work on weekends and Public Holidays Excellent communication interpersonal skills Only Singaporeans and
      417 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 6
      627 29 Hair/ Beauty Hair/ Beauty SUPER WHITE SKIN LAB Due to expansion, we are inviting candidates to join us as: 1. Beauty Consultants 2. Consultants cum Therapists 3. Customer Service Executives Only Singaporeans PRs need apply. With experience preferred Please call Desiree at 9235 1181 for an interview mjm 1. Shop
      627 words
    • Advertisement
      Lock icon Page 29 Advertisements Column 7
      750 29 Classified Jobs <P Imperial Treasure Restaurant Group Pte Ltd requires PURCHASING ASSISTANT Responsibilities: Monitor, update replenish stock Compute stock movement general goods receiving Any duties assigned by Supervisor Stock taking data-entry Requirements: Min GCE ’N’ level above Knowledge of MS Excel Outlook Express a must Capable in liaising with Mandarin
      750 words
Page thumbnail Page 30
  • Page 30 Advertisements
    • Advertisement
      Lock icon Page 30 Advertisements Column 1
      460 30 ADMIN ASSISTANT. WITH 2 yrs/ Work Permit Online experience. SPR/ S’porean only. hr@topzone.com.sg ADMIN ASST. NORTH Link/Sembawang PC Literate. Immed. S’porean spr. sreng@singnet.com.sg **ADMIN ASST REQUIRED. Computer literate multitask. 5 days week. Email: pauline@hock-ann.com.sg CO-ORDINATOR CUM ADMIN Matured. PC literate. 5.5 day Call Athena *****463 Email: ddsshd@gmail.com ADMIN ASST CUM
      460 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 2
      353 30 WEST. IMMED. A/CS A s s t (AR). 1-2 yrs experience. 5 day. *****411 SB 96C5379 A/CS ASST W/ experience @Pasir Ris. $1.6k up.Partial a/cs.Local/SPR. *****522 LEGAL SECRETARY. S’POREANS SPRs. Bilingual. No experience required. Email CV to: johns@aajplaw.com BUSINESS DEVT ASSISTANT. (Radha Exports Pte Ltd) *****439 S¡¯porean/ SPR CV: hr@radhaexports.com
      353 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 3
      293 30 An established Mechanical and Electrical engineering contractor invites suitable candidates to join our engineering team: PROJECT MANAGER(Electrical or ACMV) Degree in Electrical or Mechanical (ACMV) Engineering Good knowledge of electrical or air-conditioning installation in residential commercial buildings With excellent leadership/ communication skills Able to work independently and under pressure Minimum
      293 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 4
      648 30 Plastic molding co. requires 1) PRECISION GRINDER 2) MILLER *Min NTC *Min 2 yrs relevant experience Interested pls walk-in from 9am-12pm or 2pm-5pm to: Blk 5 Ang Mo Kio Ind Park 2A #03-25, AMK Tech II An expanding and well established Company has open vacancy for TECHNICAL SALES ENGINEER Min
      648 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 5
      206 30 PRODUCTION OPERATORS Able to read write simple English Must be physically fit to carry heavy loads All applicants must be able to work on 12-hour rotating shifts. Only Singaporeans/SPRs need apply WALK-IN INTERVIEW Wed, (22/5/13) Thurs, (23/5/13) 9am 11am or 2pm 4pm POKKA CORPORATION (S) PTE LTD 39 Quality Road,
      206 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 6
      142 30 Factory need 20 Production Workers Woodlands S’porean SPR No experience required. Full-time, 5days, Alt. Sat off. Bus pick-up/drop-off. Annual leave, medical CPF benefits. 8371 9868 8162 1977 Woodlands (Many vacancies) 7.30am-7.45pm..........$1080 7.30pm-7.45am .........$1215 7am-3pm $45+$7 3pm-11pm $50+$8 Technical Operator $1.2-1.7K Kallang 8.30-6.45pm.$1000 Annual/ Medical Bonus Trpt provided/Good benefits Call *****304/
      142 words
    • Advertisement
      Lock icon Page 30 Advertisements Column 7
      751 30 A) DELIVERY DRIVER CUM WAREHOUSE ASST ($1800++) B) WAREHOUSE ASST ($1500++) Physically fit. English-speaking. Class 3 Driving Licence for (A) Work location: 601 Sims Drive Pan-I Complex Call *****220 from Mon-Fri WOODLANDS OPERATORS μ Rotate 9-9.15 Day Night WOODLANDS OPERATORS μ 8am-5.45pm ..........$48/52 JURONG/ REDHILL μ 7.42am-5pm......$895/$52 μ Perm 1st,2nd,3rd.....$1000
      751 words
Page thumbnail Page 31
  • Page 31 Advertisements
    • Advertisement
      Lock icon Page 31 Advertisements Column 1
      516 31 Security Security Security S' N i > f LS^ /Free WSQ training provided yReoular pay review/ half-yearly bonus Joining Bonus of up to 1 E AAA* for all Singaporeans »^/WWW Earn up to $3,100* AUXILIARY POLICE OFFICERS Requirements: 3'N 1 Levels/NITEC 1 'O' Levels Diploma in any discipline Physically and
      516 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 2
      186 31 Security Security G4S, the world’s leading international secure solutions group and have operations in more than 125 countries and 657,000 Supervisors $1,900-$2,100 per month Security Officers $1,700-$1,800 per month Tuas MNC Free Transport from Jurong East CCK S’poreans PRs only Annual childcare leave 1 day off per week Valid Security
      186 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 3
      317 31 SECURITY OFFICERS/ SUPERVISORS Yio Chu Kang, Seletar Woodlands, Bencoolen, Bendemeer others. Daily $60-80 Mthly $1700 to $2300 Pls call: *****327 Security Officer $70 Take Home Daily *****011/ *****063 *****071/ *****930 SECURITY FIRM REQUIRED 1) SUPERVISOR 2) SECURITY OFFICERS 6 days off per month Please call *****013 Assign Vivo, Woodlands, Northpoint,
      317 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 4
      436 31 SECURITY OFFICERS $1.8K 5 day work, 2 day off WSQ trained or Ex-SPF, SCDF Customer Service oriented Well-groomed Planned career path Benefits 13th mth AWS, Qtrly Performance Bonus, Annual Medical Leave, Medical Reimbursement Location Novena, Sentosa Havelock *****220 WALK IN INTERVIEW 9AM -5PM Blk 1 YS-ONE Yishun St 23 #06-03
      436 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 5
      413 31 Tanglin Mall food court Orchard Rd requires 1. Fruit Cutter 2. Dish Collector S’poreans/ SPR only Meals provided incentives Call: 9748 9326 Requires CLEANING SUPERVISOR Possess Class 3 lic 5 days week Staying in Yishun Call *****121 Cleaning Co.Needs FLOATER Interested pls call Alan *****048 PRIMECH SERVICES ENGRG PTE LTD
      413 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 6
      513 31 HOTEL CLEANING Mohd Sultan Rd. 1) Night Supervisor, 11pm-8am $1500 neg 2)Night Cleaners,11pm-7am $1200. 6 days wk. Immed. Call *****392. No agent. CLEANERS URGENTLY REQUIRED 1) SPA/ Fitness center (Tanglin Rd). Morn shift 2) Orchard (morn shift) S’porean/ SPR only. Call 9006-4310 SHOPPING MALL NEAR Expo MRT requires Cleaner for
      513 words
    • Advertisement
      Lock icon Page 31 Advertisements Column 7
      495 31 Catering Co. requires Delivery Drivers Catering Assts. << Good Pay >> Call 6288-4457 Walk-in interview 7 Lichfield Rd (S) *****7 (Off S’goon Garden Way) DELIVERY STAFF Retirees are welcome Valid driving license Company car provided Interested applicants, please contact: È *****591 Int’l Courier Co. requires: 1. DESPATCH DRIVERS (Class 3)
      495 words
Page thumbnail Page 32
  • Page 32 Advertisements
    • Advertisement
      Lock icon Page 32 Advertisements Column 1
      767 32 An international F&B Co. at Gourmet East Kitchen Bedok North Ave 4 requires: Drivers (20’ truck, Class 3) S$1,800minimum starting pay. Delivery Store Assistants S$1,450minimum starting pay. Salary benefits review upon successful completion of probation. Those with experience in catering operations an advantage (but not essential). For enquiries interview appointment
      767 words
    • Advertisement
      Lock icon Page 32 Advertisements Column 2
      776 32 Other Positions Other Positions Other Positions Soar through a world of possibilities At SATS, it’s a world of opportunities all in one place. For more than 60 years, our diverse operations in gateway services and food solutions worldwide have opened up unlimited opportunities for passion to soar. APRON SERVICES Cabin
      776 words
    • Advertisement
      Lock icon Page 32 Advertisements Column 3
      1308 32 Main board-listed Singapore Press Holdings Ltd (SPH) is Southeast Asia’s leading media organisation, engaging minds and enriching lives across multiple languages and platforms. It publishes 18 newspaper titles in four languages and more than 100 magazine titles in Singapore and the region. Every day, 3 million individuals or 77 per
      1,308 words
    • Advertisement
      Lock icon Page 32 Advertisements Column 4
      209 32 ADMIN/ CUSTOMER SVC GOVT. 1-3mths ’O’level/Dip /Deg. $6-$8/hr. *****787 Ace Recruiters (95C5048) BRIDAL PHOTOGRAPHY MODELS. Students welcome. No fee. IMI *****211 APPT SETTING OFFICERS. 3/6 hrs. $10-$12/hr. Alexandra. Immed. 9067-4504 MOMS BACK TO Work. Only Locals/SPR. Call *****698 Hireright Pte Ltd (11C4316) EXPERIENCED WEEKEND PH Fashion Retail Staff required. Call
      209 words
Page thumbnail Page 33
  • Page 33 Advertisements
    • Advertisement
      Lock icon Page 33 Advertisements Column 1
      697 33 CareersforYou A list of career opportunities found in Saturday’s (18 May) issue of the CATS Recruit Company Name Contact Information Job Title Company Name Contact Information Job Title Ministry of Foreign Affairs www.mfa.gov.sg/career Foreign Service Officer (Functional and Corporate Services) Foreign Service Officer (Political and Economic) Resorts World Sentosa Singapore
      697 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 2
      161 33 Classified Jobs d Executive Appointments More than 100 vacancies available for Singaporeans and SPR Only! WALK IN INTERVIEW on 23 May 2013 fr 2-5pm! Mendaki Pasir Ris Blk 253 Pasir Ris St 21, #01-233 Singapore *****3 Tel: 6248 5999 1. Admin Asst........... O Level 2.Catering Asst........ No Min 3. Staff
      161 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 3
      411 33 Main board-listed Singapore Press Holdings Ltd (SPH) is Southeast Asia’s leading media organisation, engaging minds and enriching lives across multiple languages and platforms. It publishes 18 newspaper titles in four languages and more than 100 magazine titles in Singapore and the region. Every day, 3 million individuals or 77 per
      411 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 4
      120 33 CASH MANAGEMENT OFFICER IMMEDIATE VACANCY!! Earn up to$1500 Minimum Secondary 2 Singaporeans SPR For interview, pls call: 8498 6530 BUTCHERS/ RETAIL ASSTS û Work in NTUC Supermkt û $1.5K up incentives û Full Medical Benefits 14 Days Annual Leave û 6 days work week û Strictly S’poreans/ SPRs only *****966
      120 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 5
      106 33 IMMED. 2 DISHWASHERS at Northpoint. Food provided. $1500. 1 month 2 days off. Pls call 6316-6728 CAR WASHERS Petrol Kiosk islandwide. Full Parttime. Daily allowance. Call 9643-0369/9006-7668 LANDSCAPE WORKERS AT Jurong/ Bukit Batok S’porean SPR only. Start work on 1st June. *****527 FOOD FTY NEEDS Packer. Nearby Woodlands. Please call
      106 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 6
      59 33 FORKLIFT DRIVER General Workers ($60/ day) needed Pandan Ave. Pls Call: *****018 GENERAL WORKERS Welders required by Metal Recycling Co. Defu area. Pls call 6858-4278 PEST CONTROL CO requires Vector Control Workers. Prefer with class 3 lic. With or w/o NEA lic. 6344-5009 ***50 EVENTS PROMOTERS No experience. ’N’/’O’ level
      59 words
    • Advertisement
      Lock icon Page 33 Advertisements Column 7
      64 33 1) NIGHT DUTY OFFICER 2)Handyman needed in Raffles Place. 5 days work. Immed. Call 9678-6568 CHILDCARE CLEANER. PART /Full-Time required. Along AMK Ave 3. Call *****300 CAR WASHERS Marsiling Geylang.S’porean PR. Call *****362 *****206 FULL/ PART-TIME Night Cashier needed Novena/ Guillemard. Call: *****998 REQUIRES HANDYMAN CUM Driver to work in
      64 words
Page thumbnail Page 34
  • Article, Illustration
    Lock icon How to be a success magnet
    735 34  -  Here are some pointers to help you achieve your aims in life Article contributed by Christian Chua motivational speaker and success coach with Richard Gavriel Speaker Management. He has helped raise the productivity and sales performance of many organisations. Contact him at Richard@RichardGavriel. com.
    735 words
  • Page 34 Advertisements
    • Advertisement
      Lock icon Page 34 Advertisements Column 1
      756 34 Classified Jobs 1800-289-9988 www.cats.com.sg/recruit Executive Appointments 1800-289-8822 Upcoming CATS Recruit job features: Careers in the Public Sector: 22 June 2013 (Sat) Careers in Health Care: 29 June 2013 (Sat) Careers in Early Childhood Education: 13 July 2013 (Sat) Careers for You A list of career opportunities found in Saturday’s (18
      756 words
    • Advertisement
      Lock icon Page 34 Advertisements Column 2
      91 34 Find out how you can transform yourself into someone with an attractive personality and great attitude at the STJobs workshop How To Be A Success Magnet on May 30. To register, log on to stjobs.sg/seminar. Sign up now to enjoy early-bird prices. To send article contributions, comments, views and story
      91 words