The Straits Times, 15 June 1996
1996-06-15
1
62
https://www.nlb.gov.sg
https://eresources.nlb.gov.sg/newspapers/browse/straitstimes
The Straits Times
-
Title Section14 1996-06-15 1 The Straits Times Estd. 1845 SATURDAY, JUNE 15, 1996 60 CENTS MITA (P) 047/12/9514 words
-
Article, Illustration631 1996-06-15 1 LONDON Sumitomo Corp said a former chief trader lost US$l.B billion (552.5 billion) on bets in the copper market that he concealed from the company for a decade, prompting an emergency meeting at the London Metal Exchange (LME) as prices fell. Copper pricesNYT - 631 words
-
Article, Illustration549 1996-06-15 1 Allison Lim - Allison Lim By- IN A dramatic demonstration of a mother's love, housewife Poh Siew Kuan underwent a major operation last Saturday to give her 19-month-old son a part of her liver. It was transplanted into the toddler, whoAZIZ HUSSIN - 549 words
-
190 1996-06-15 1 SEOUL A group of three North Korean patrol boats intruded into South Korean waters yesterday as Seoul conducted its biggest-ever civil defence drill triggering a tense but non-violent standoff with Southern navy ships, military officials said. The reported intrusion the latest in a stringAFP; Reuter - 190 words
-
Article, Illustration69 1996-06-15 1 FANDI Ahmad, surrounded by his Geylang United team-mates, holds aloft the Tiger Beer Series trophy The team won the $50,000 prize for capturing the first series of the inaugural S-League soccer tournament. Geylang was held to a 2-2 draw by Woodlands Wellington at the National Stadium lastJERRY SEH - 69 words
-
Article, Illustration555 1996-06-15 1 Ng Wei Joo - Ng Wei Joo Monthly income also up by 73% By THE average monthly amount which households in Singapore spent almost doubled between 1988 and 1993, from $1,548 to $3,034. During this period, spending on items like transport and communication, housing, education and clothing555 words
-
Page 1 Advertisements
-
Advertisement237 1996-06-15 1 uw* a* nan ffnSrff^Sh.M"Q 9 SHIQO MflllUfßCtUvifiCi rfo Liu .-^tT 81ll i No22D«luL«««l,Slns«p<x»l9S«T.< 7«4»1tF»» *****75. Tt1« BS393O9KINSHU I Living-related transplants only as last resort: Pg 29 iifJlS^ http://wvvw.QsiGi .com.sg/straitstimes KIWWAI SAIVIICK (100% MADE ASSEMBLED IN JAPAN) (100% MADE ASSEMBLED IN SOUTH KOREA) j Awarded the ISO 9002 Japan (JIS) SXorea237 words
-
Advertisement103 1996-06-15 1 NVjwk E^ ■]f jHH PW More on survey: Page 26 Blan'cpaiN I 'iWaSff-i'-'''^ "^i\ \V\ vfll PiHfl 'Hi vt, lfU\\ A,9fl ¥9 f>~'' ''"sT I *i^ '■■■'il sin '■'l^ fg C\ Qjdm^k Screw-in caseback and crown 100 hours power reserve 100 meters water-resistant Since 1735 there has never been a103 words
-
-
NEWS FOCUS
-
468 1996-06-15 2 Tan Tarn How - Tan Tarn How By China Correspondent BEIJING China and the United States yesterday extended lastminute talks on copyright piracy after failing to reach a solution three days before tit-for-tat sanctions take effect. The talks will continue today with the participation468 words
-
Article, Illustration384 1996-06-15 2 TOKYO Police raided the local offices of Garuda Indonesia Airways yesterday as investigators suspected that negligence on top of engine trouble caused the DC-10 jet crash at Fukuoka airport a day earlier. The raid was carried out on suspicion that the deaths andAFP; Reuter - 384 words
-
503 1996-06-15 2 FROM next June, all cosmetic products will w have to bear content labels, and local makers and importers of some products will have to apply for a licence from the Health Ministry: A ministry's statement yesterday said the new regulations503 words
-
797 1996-06-15 3 Neville Stack - Neville Stack Reports by in Paris Ties have gone beyond 'more trade and culture' SENIOR Minister Lee Kuan Yew foresees even better prospects for further cooperation between Singapore and France. "It is a year since my last visit, and there is a better mood, I797 words
-
495 1996-06-15 3 THE convergence of economic policies of Singapore's neighbours with those of the Republic means that the going is going to get fough for it unless it stays ahead with "that extra zip", said Senior Minister Lee Kuan Yew. He made the comment on Thursday495 words
-
Article, Illustration333 1996-06-15 3 Newgeneration bus stops I This bus stop outside the UIC Building along Shenton Way costs over $60,000 to install. It has these features: ENJOY a cool breeze, take a sip of ice-cold water or call your best friend all while waiting for your bus. ThisAziz Hussin - 333 words
-
395 1996-06-15 3 Ginnie Teo - Ginnie Teo By THE dead man, Mr Tan Keng Ann, was a good field officer who won two commendations from the Central Narcotics Bureau (CNB) last year. One was for a case which resulted in the conviction of two drug395 words
-
-
Page 2 Advertisements
-
Advertisement158 1996-06-15 2 JIGSAW! SHOCK I puzriewith obscene picture [Fading fi while ii— tl THEBUSINIJSSTIMIiS Singapore copper traders brace for the worst PLUS: ♦Events leading to the USsl.Bb copper trading losses at Sumitomo Corp; ♦Reaction from the London Metal Exchange. Hock Lock Slew It's not too early for foreign stockbrokers to gear up158 words
-
Advertisement27 1996-06-15 2 ..I, I. i i M i^ i B BBi^^^^^-'. |B i rii r ll' I v l I M I k Bv: I t f P 127 words
-
-
Page 3 Advertisements
-
Advertisement367 1996-06-15 3 I KEWGATE I At Upper East Coast Road Kew Drive |i 3 Storey Cixjster Houses Wrm Ounxx)R Recreational Facilities Hgßf^j^^i. '^"-fll ?^H IkV HJHE— wP jfe Bk Tilly ftk j.^?*-^:" HPWw; I p^*r:> iMi'l r/iTi PJ i I* li/iiT) BBbeSw bHbtbst '<*^^~ ■1/hji/ mI 11/ (11 L /ill 111/ "v367 words
-
Advertisement65 1996-06-15 3 No Collection Is Started Or Completed Without Viewing The Tomlinson's Our 12 000 sq ft showroom offers Chinese Antique Furniture Han Tang Terra-cotta Figurines Ancient Angkor Wat Sculptures Buddha Images Dragon Robes Three Drawer Coffer Huanghuali Wood 18th Century TOMLINSON ANTIQUE HOUSE 460 Sims Avenue Singapore *****1 Tel: (65) 74465 words
-
-
WORLD
-
472 1996-06-15 4 Move to show solidarity with workers whose wage deals were hit by government spending cuts J BONN German Members of Parliament have voted to do without a pay rise this year out of solidarity with public-sector .workers whose wage deals haveReuter; IHT - 472 words
-
322 1996-06-15 4 DHAKA Sheikh Hasina Wajed began work I yesterday on forming a new Bangladeshi govI eminent following the victory of her party, the Awami League, in a general election declared I free and fair by foreign observers. Although the results fromAFP - 322 words
-
Article, Illustration416 1996-06-15 4 Freemen members surrender to FBI JORDAN (Montana) —The longest federal siege in modern US nistory ended without bloodshed on Thursday when all 16 anti-government Freemen holed up for 81 days at a remote Montana ranch surrendered to the FBI. The tense stand-offended dramatically whenReuter - 416 words
-
295 1996-06-15 4 Plot to kill New York politicians with radiation uncovered RIVERHEAD (New York) Investigators uncovered an apparent plot to assassinate several New York politicians with radioactive material, the Suffolk County authorities have said. District Attorney James Catterson told a news conference on Thursday that two men had been arrested and chargedReuter - 295 words
-
Article, Illustration629 1996-06-15 5 'June 16 is Russia's day of destiny.' Mr Yeltsin* MOSCOW President Boris Yeltsin tried to rally a disenchanted electorate behind his bid to stop communists returning to the Kremlin as the cam- paign for tomorrow's Russian presidential electionsReuter; AFP - 629 words
-
Article153 1996-06-15 5 LOS ANGELES Cindy Crawford's publicist has denied a British newspaper report that the supermodel was briefly kidnapped in Paris two months ago. "There is no truth whatsoever to reports Cindy was kidnapped," Annette Wolf said on Thursday The Sun. Britain's largestcirculation tabloid, said it had been toldReuter - 153 words
-
WORLDFILE
-
Article57 1996-06-15 5 The US Supreme Court invalidated five congressional districts, saying they were drawn mainly for racial reasons. The two decisions on Thursday, made in 5-4 votes of the court's nine justices, found unconstitutional the mapping of five congressional districts in Texas and North Carolina, saving they did not affordAFP - 57 words
-
Article49 1996-06-15 5 Bus, subway and commuter train fares in the Paris region would go up on July 1, the Syndicat des Transports Parisiens said on Thursday. Single tickets for rides in central Paris and its suburbs will rise 6.6 per cent to eight francs (552.16) from 7.50 francs. AFPAFP - 49 words
-
Article44 1996-06-15 5 The United States said it might impose trade sanctions on Colombia after its legislature absolved President Ernesto Samper of drug-related charges. State Department spokesman Nicholas Burns said on Thursday that visas for Colombian officials and counter-narcotics assistance might also be withdrawn. ReuterReuter - 44 words
-
Article47 1996-06-15 5 United States citizens who were imprisoned by the Nazis in World War II concentration camps would be compensated by the German government, Attorney-General Janet Reno said on Thursday. Bonn has agreed to pay US$2.l million (552.9 million) to American survivors of the camps. ReuterReuter - 47 words
-
Article72 1996-06-15 5 Mexico's high crime rate soared when a helicopter was stolen from the capital's international airport, airport officials said on Thursday. "Yes, it was stolen. This has never happened before," said Mr Rodolfo Sotelo, deputy director of communications at Benito Juarez airport. He said they believed the helicopter wasReuter - 72 words
-
Article66 1996-06-15 5 A Canadian greeting card chain, Canton Cards, has recalled, from its 265 stores, a series of Father's Day cards that make light of infanticide. A Winnipeg woman complained on Thursday after seeing a card that read: "Happy Father's Day from your loving daughter and thanks for notReuter - 66 words
-
-
Article, Illustration617 1996-06-15 6 Peacekeepers to help curb influence of war criminals on elections: Official PEACEKEEPERS TO: Conduct more robust patrols with "tougher rules of engagement" regarding detention of war criminate Step up role to return refugees and maintain law and order. I Help with voter registrationAFP - 617 words
-
Article, Illustration303 1996-06-15 6 PHOENlX— Arizona Governor Fife Symington has been indicted by a federal grand jury on 23 counts including fraud and attempted extortion. MsNoraManella,US Attorney for the Central District of California, said on Thursday the indictment charges Symington, 51, a former real estate developer, on 16Reuter - 303 words
-
219 1996-06-15 6 WELLINGTON A semi-ju-dicial body ruled yesterday that the government had illegally seized 778,000 ha of land now worth several billion dollars from native Maori tribes which must be compensated for the injustice. The Waitangi Tribunal said the seizures from Maoris of theAFP - 219 words
-
215 1996-06-15 6 WASHINGTON The US Board of Immigration Appeals has for the first time granted political asylum on grounds of female genital mutilation, ruling in favour of a Togolese teenager who feared she would be subjected to the practice. The rite is practised on millionsNYT - 215 words
-
188 1996-06-15 8 LONDON A government survey has shown that British education and training compares well with most of its major economic competitors, Deputy Prime Minister Michael Heseltine has said. Introducing the third in a series of annual White Papers on British economic competitiveness, he said onReuter; AFP - 188 words
-
Article, Illustration588 1996-06-15 8 "Everyone must choose what to do with their own money Lady Thatcher must answer for her own actions. Personally, I would have given the money to the Conservative Party.' Prime Minister JohnMtyor. It is well known that the advocates of European federalismAFP; Reuter - 588 words
-
451 1996-06-15 8 PARIS A report that Britain exported huge amounts of potentially BSE-tainted animal feed at the end of the 80s has sparked angry recriminations on the continent, with some accusing Britain of criminal acts. French ire was particularly roused, since theAFP - 451 words
-
Article, Illustration57 1996-06-15 11 ISRAEL Antiquities Department workers preserving a Roman menagerie mosaic on Thursday in Lod city near Tel Aviv. The rare 1,600-year-old mosaic floor of a large room in a Roman villa was discovered earlier this month. The mosaic, filled with scenes of wild animals, is one of the mostAFP - 57 words
-
Article, Illustration429 1996-06-15 11 Abraham Rabinovich - Abraham Rabinovich By in Jerusalem PALESTINIAN leaders this week warned of a resumption of the intifada, or uprising, if Israeli Prime Minister-elect Benjamin Netanyahu drags his feet on the peace process. In a series of interviews in the Palestinian media, senior429 words
-
181 1996-06-15 11 WASHINGTON Jordan's King Hussein and US President Bill Clinton have reaffirmed their goal of a broad Middle East peace despite Arab concerns over Israel's new right-wing leadership. Mr Clinton told reporters at the White House after Thursday's talks: "We affirmed our partnership forAFP - 181 words
-
139 1996-06-15 11 TEHRAN Iran has said 150,000 hand-picked Revolutionary Guards will hold war games code-named "Road to Jerusalem". Guards Commander General Mohsen Rezaei told the Iranian news agency Irna on Thursday that the exercises would be held by 150,000 men. He said trainingReuter - 139 words
-
177 1996-06-15 14 foEW DELHI Indian detectives yesterday began interrogating the son of former Premier P.V. Narasimha Rao for his alleged role in a shady fertiliser deal, the latest scandal to hit the beleaguered national leader. A spokesman for the Central Bureau of Investigation (CBI) saidAFP - 177 words
-
455 1996-06-15 14 Military action possible if UN accepts proposal UNITED NATIONS The United States and Britain have urged the UN Security Council to declare Iraq in violation of the 1991 Gulf War ceasefire, a proposal some believe raises the prospect of military action. DefyingReuter - 455 words
-
PEOPLE
-
Article, Illustration191 1996-06-15 14 But admits to breaching medical secrecy at trial PARIS Fortner French President Francois Mitterrand's personal physician Claude Gubler, who lied for a decade U help the late President conceal his cancer from the nation, went on trial in Paris on Thursday for tellingReuter - 191 words
-
Article68 1996-06-15 14 JAKARTA An Indonesian governor and staunch opponent of smoking has intensified his personal campaign against the habit by refusing to handle documents smelling of tobacco, a press report said yesterday. "You can expect me to refuse any document that smells of tobacco," South-east Sulawesi GovernorAFP - 68 words
-
Article, Illustration108 1996-06-15 14 LONDON Triple Wimbledon tennis champion Boris J Becker may buy his next title Lord of Wimbledon from Princess Diana's brother, according to British newspapers. The German who at the age of 17 became the youngest winner ever of the men's title in 1985 is interested inReuter - 108 words
-
Article163 1996-06-15 14 SAVAGE BEATINGS: A New York City man, John m Royston, confessed to the shocking daylight attack on a woman in Central Park as well as two other recent savage beatings that have jolted the 4jity, police said on Thursday^ THANKS TO SOAP OPERA: Radio engineer Rodney Haverson, 52, a163 words
-
-
-
Page 4 Advertisements
-
Advertisement160 1996-06-15 4 Indulge in the warm, Idj I I I I%* JJL right to the bedroom m mm J^V (w £21 1 #3 where you rest. HfiEi Jmsk %*^BLnt4m* t jm M w I W^l^^A '^&§Km. eXf Cm The brilliance of the colours from our magnificent lighting BSI especially the eminent chandeliers160 words
-
-
Page 5 Advertisements
-
Advertisement204 1996-06-15 5 Feast your eyes on the much awaited JSmI t Jl |Rl| Razi's kilim auction. A fabulous J3k JiSI collection of Persian Caucasian rare, Ifj Ef- Jj ?&S%'S old and antique kilims, promising ££fl ?>*„ 1H more variety, exciting designs J^l SF^i fc^M?O and colours for your If discerning taste. i^J204 words
-
-
Page 6 Advertisements
-
Advertisement425 1996-06-15 6 AijlF Jl BSfcjFHir^ ust °PP os te Mandarin Gardens I VJ| M^P P^^^^ at Siglap Road/Marine Parade Road, X^^^^Z* W W* r *^<tt I Bbzl Wg>W site area ot about 461,000 sq. ft., 1 I '-^1 1 a "-^ll Kl VILLA M\RINA, the only prime luxurious |MAJRJLNAbI| l^^*^l fek condominium425 words
-
Advertisement132 1996-06-15 6 s-U^ Interested in C atrc AVIATION ±*h CAREER v4-<f training overseas? Aviation is one of the world's most exciting careers and offers a broad range of opportunities where your future potential is almost unlimited. It is also one of the fastest growing industries which needs young enthusiastic and well trained132 words
-
-
Page 7 Advertisements
-
Advertisement277 1996-06-15 7 ANNUAL CLEARANCE SALE 50% 90% DISCOUNTS V W Diamond Industries i ym^pr- j ar g est |oo per Our Annual Clearance Sale is still Wttt dlfHtiOitd COllOCtlOlt the current rage everywhere! For the last few weeks, ml J lm iii«j^ we Ve held very firm prices for all our beautiful277 words
-
-
Page 8 Advertisements
-
Advertisement309 1996-06-15 8 t» Iff Jtoftlfttt t^Slpoce Shopping Centre #01-23 Tel: 339 1058 1 319 SINGAPORE WOODCRAFT MFG CO PTE LTD Ijl |gC Main Showroom: Muttl Colour Furniture Bidg. S A Shaw Centre, Scotts Road #03-01 Tel: *****47/8 W for Rosewood .W* o K I No. 1 choice Jjg gK P^ g foryoul309 words
-
-
Page 8 Miscellaneous
-
Miscellaneous333 1996-06-15 8 SINGAPORE Showers over several areas in I High: Sunset today: the late afternoon and early 32 7 11 P" 1 evening. low Sunrise tomorrow: Rl 24 6.59 am For an update on the local weather, call 542-7788 AIR QUALITY— PSI (at 4 pm yesterday): 37 (Good) Abidjan 23/28C Showers Kuala333 words
-
-
Page 9 Advertisements
-
Advertisement835 1996-06-15 9 8(5 HSMIwS A 5fe l if y DaVld n T-shirt fw W P^^^^j Sports l^fH KMUfiii|fiiBipii| B^ Bk (Scotts Katong) B #%il A/% SfP Im V R^fl^ B^^ i Bfi A v l-^^Ox^ A PT9 K^ i^faiUk «I Ik !< IbM X>^^^aliltSK\ Major League VV B W rff^P IL iilHik^toil835 words
-
-
Page 10 Advertisements
-
Advertisement1095 1996-06-15 10 iimmmmm/fli 1 Create a cosy ambience in the sanctuary where you 'I^S ||Wl liK^f^'^^^^^Bfcß^B^Biiß^Bl iiaEaajflß retreat to when the night falls... or whenever you reel I like falling into a slumber. Delight yourself by furnishing Baflj WF >JRi[^ iiiiifllll^ your sleeping chamber with the bedroom suite that I j expresses1,095 words
-
-
Page 11 Advertisements
-
Advertisement142 1996-06-15 11 H A TOAST TO THE PERFECT UNION. YOU AND CHAO PHAYA. j| B*LQ Chao Phaya understands that perfect Free suite in Oriental Hotel. BjnQ mnk weddings need perfect preparations. Free limousine service. WmM WM Which includes glorious food, a great $200 cash vouchers. Wck Nttl venue and the finest presentation.142 words
-
Advertisement482 1996-06-15 11 |j Magic Carpets At Magic Prices. h< Persian Turkish Russidit »9 I Turkoman Balouch rM' pPrices From $95.00 for a limited period only! Don't miss the opportunity to fly away with a bargain! E View At Free Car Park Outside C.B.D^ m^ k. Kashmir Carpet House Ptc Ltd -I'f WjT^^k482 words
-
-
Page 12 Advertisements
-
Advertisement1672 1996-06-15 12 THOItISON flfli 72MT92 Black Quadra Wk ii, M j^Mf CLJADD V_Prfr B _i #ii I 29 CTV w/fh wto-sytem, dnAKr BJT A _Ttl I NICAM stereo, surround k7aT7^9 29FX5 29" Super flat fllT^ B_V Jound connection, CA7V K*7A >f CTV with NICAM digital "F^^^^^^^^ '>' ■Jwilllfl P"* Bk ca P1,672 words
-
-
Page 13 Advertisements
-
Advertisement1193 1996-06-15 13 Standard Installation J L»- 8 k I I I%^\AAl^ll^* A *S/S Bracket M^_^jilllll_Jl^llJzil^^^^^ s?; 4 B^>fe^ Hs B l/V/IVIIINIVA 4 *Hl 32" autO MmHHHJHHBHM i ::-^UJU^^=: >-^-^==^ Sr^'/lp"^' r™^F™^^«^Bl w/rt febr/c up/io/sfen/ in /\\\(l\ 'SfsJi"ll //devv K»BBBB«BBM1 y "■;}.;pry Bb^^WJ K^*^ IMf f" > I lradilional chintz flora/ P nn1,193 words
-
-
Page 14 Advertisements
-
Advertisement503 1996-06-15 14 3S»«»»^^ELa«*- HBmI VA. Pare Vista, your home is more than a 17.',.'. 'VS B*' I |§y^ 4 fyr* JOBHBM MPpwsg collection or rooms. Here, in the luxuriant .^M Hfff iIH l 'iHPfc ■■■> I <_^/he grandeur of the Neo-Classical era is reborn in the design of Pare Vista. With a503 words
-
-
Page 15 Advertisements
-
Advertisement119 1996-06-15 15 < %SC^S P^ LatestJa P anese |few Luxury Children's Bedroon) FJbr^yUX ?£WM Mokisa Sofa Set 3+\+ l Bl^' r.___l! inl <B^r^\fl>. fel Jtfjth ■CeitinS^^"" -~*A C tyT 9ORI CUIIfIH Kti^j^ v**"^ *s!S?S<ik ir^B "BBtBTttI I BS/ v! Sude T<flßß \^s^*^*^ti TV ioong^M IBflttl I L ii d| sVr^*- I 'i119 words
-
Advertisement1208 1996-06-15 15 N DONESIA MALAYSIA TA/IVAN T \CMo*7hci(jk\ LIMITED Incorporated in Singapore BRAND'S EXCELLENT PERFORMANCE CONTINUES PROFIT BEFORE EXTRAORDINARY ITEMS 15% AHEAD OF LAST YEAR Results For The Half-Year Ended 31st March 1996 The Directors are pleased to announce the unaudited results of the Group and the Company for the half-year ended1,208 words
-
-
EAST ASIA
-
314 1996-06-15 16 SEOUL Sirens wailed and air force fighters streaked across South Korea yesterday in the largest ever civil defence drill designed to test revamped warning systems against possible North Korea attack. South Korea has overhauled its warning and airReuter - 314 words
-
185 1996-06-15 16 TOKYO Japan might file a complaint against the United States with the World Trade Organisation (WTO) over photography products as a count-er-measure against a similar move by Washington, news reports said yesterday. "There is an exclusive practice" in the USAFP - 185 words
-
372 1996-06-15 16 SHANGHAI As Chinese and US negotiators seek to avert a trade war over copyright abuse, a Shenyang software company which will be listed next week is hoping for an outcome that will protect its interest. Shenyang Neu-Alpine Software Co, based in China's northern LiaoningAFP - 372 words
-
Article99 1996-06-15 16 BEIJING The authorities in south China's Guangdong province, which US officials said is a hotbed for piracy, have seized thousands of fake brand name men's underwear, a Beijing-backed newspaper said yesterday. The authorities raided an underground factory in Jinsha village on Thursday and seized 170,000 yuanReuter - 99 words
-
Article, Illustration691 1996-06-15 17 Chance for Taipei constitutional discussions next year: Report THE present constitutional deadlock provides an opportunity for Taiwan's three major political parties to discuss constitutional amendments next year, said a highranking official from the presidential office, according to the China Times yesterday. President LeeReuter; AFP - 691 words
-
Article, Illustration127 1996-06-15 17 SHANGHAI Police in China's central Hunan province had arrested a robber who allegedly killed 17 people and htd been on the run ror the past nine years, a newspaper reported. The Wenhui Bao daily reported that police seized the "prince of evil", HanAFP - 127 words
-
382 1996-06-15 17 i BONN The German government has got embroiled in a row with China over Tibet, as the Tibetan spiritual leader, the Dalai Lama, arrived for an international conference I on the Chinese-ruled Himala--1 yan territory which has infuriated Beijing. The Chinese authorities at-AFP - 382 words
-
Currents in the News
-
Article133 1996-06-15 17 Teng-hui overriding Parliament Editorial of Taiwan's United Dally News, a mass-circulation and pro-unification paper: By retaining Vice-President Lien Chan as Premier, President Lee Teng-hui has ignored the constitutional controversy over the matter as well as deprived the Parliament of its right to exercise the power of consent. Viewed against the133 words
-
93 1996-06-15 17 Anthony Yuen, a US-based political commentator on East Asian affairs who writes for Uanhe Zaobao: The opposition Democratic Progressive Party and New Party have threatened to boycott all future Kuomintang Bills if the Parliament is not allowed to exercise its right of consent over the93 words
-
Article121 1996-06-15 17 Move of 'a monster and beast' Zhou Qlngchl, In an article contributed to Lianhe Zaobao: President Lee Teng-hui was quoted by the press as saying that the Parliament is like a "monster" but the opposition lost no time in calling him a "beast". But if we look carefully at the121 words
-
Article108 1996-06-15 17 Editorial of Hongkong's Sing Tao Daily, an independent newspaper: Taipei wants cross-strait relations to be based on the principle of "equality" and Taiwan has strengthened its position with economic growth, a strong defence, and democracy. If both Beying and Taipei refuse jto compromise, not only108 words
-
-
Article, Illustration426 1996-06-15 19 But French builder has not handed over operational manual and line blueprints TAIPEI Almost two weeks after the computer failure that caused a five-hour breakdown of Taiwan's Mucha commuter railway line, the service is running without the computer programmer manual or even the finalTimesgraphics - 426 words
-
668 1996-06-15 19 Lee San Chouy - Lee San Chouy Government inefficiency Reports By Taiwan Correspondent 'Special' interference Bad planning and lack of expertise TAIPEI Overall government inefficiency, "special interference" from figures of authority, bad planning and a lack of expertise are the reasons for Taiwan's problem-riddled Mass Rapid668 words
-
-
Page 16 Advertisements
-
Advertisement600 1996-06-15 16 View that special moment b^. as soon as you shoot it! A The CASIO QV- 10 LCD Digital Still Camera Wk makes it possible to record "visual memos" of those special moments when they happen. W" *"*"""X R eca ll a n Y of the images stored in the 1600 words
-
-
Page 17 Advertisements
-
Advertisement206 1996-06-15 17 HH|H You Need Not Pay A High Price I or Our Quality Design. I V»" ill -vi L y +3^ 5 Seater Full Leather Set d^CQA §2^" 3-piece Set (I+l*3) > IJOU I \^£ost e I cuoVW^SS Matching Corner Tables Available a» existing orders shad not be varied II it206 words
-
-
Page 18 Advertisements
-
Page 19 Advertisements
-
Advertisement219 1996-06-15 19 i 'i Now till 30 June 96, 82. Household Department, > "«ii»%l kr dtifl *K -^""**^tell*f% i£ir~ The First 50 cuitomers ■I \J JW m& J^^^fc are entitled to purchase n^' i£ *^Wry ,^^f22% m\ \m^--~-" this Henckels Four Star A n|/ "*""^KB^^| K I Cooks Knife at j/fSS^% *****-000219 words
-
Advertisement128 1996-06-15 19 f I I B r An incredible buying opportunity for J first-time buyers and serious collectors. M Flush with the largest collection of exquisite carpets in the Far East^ Hassan's new 2| arrival of Persian carpets is rich in quality, beauty and value for money. From a collector's standpoint, this128 words
-
-
SOUTH-EAST ASIA
-
Article, Illustration53 1996-06-15 20 A PLAINCLOTHES policeman carrying a handgun (left) struggling with a squatter who was blocking the demolition of shanties in suburban Manila on Thursday. About 70 shanties were demolished to make way for a government water-pumping station. Squatters fought members of the demolition team with stones and wooden clubs.AFP - 53 words
-
430 1996-06-15 20 Satwant Kaur - Satwant Kaur iy in Phnom Penh TWO Singaporeans were attacked on Wednesday night in a bizarre incident of armed robbery and intimidation. Mr Freddie Teo, First Secretary at the Singapore Embassy in Phnom Penh, was getting into his car with his wife in430 words
-
389 1996-06-15 20 Neville Stack - Neville Stack By in Paris "The army]s power cannot be ignored' THE opposition in Myanmar has to face the reality that the one instrument of effective government or power in that country was the army and that it could not be ignored, Senior389 words
-
Article, Illustration381 1996-06-15 20 Leticia Perez - Leticia Perez Reports by in Manila THE Asia-Pacific Economic Co-operation (Apec) can exert "benign pressure" on Japan to open up trade and the United States to refrain from taking unilateral trade action, Singapore's Ambassa-dor-at-Large Tommy Koh said yesterday. Apec could also381 words
-
383 1996-06-15 20 TOP businessmen in the Asia Pacific region are gathered here for the Apec Business Advisory Council (Abac) inaugural meeting today, the first of two meetings organised to draft recommendations on how trade should be conducted in region. Trade liberalisation and facilitation, Apec business co-operation and383 words
-
Article, Illustration67 1996-06-15 22 A fisherman pouring petrol to burn the body of a dead Baleen whale washed up on the shore of San Fernando in the northern Philippines facing the China Sea on Thursday. The rare 7.3-m whale bore huge lacerations and open wounds on its body when found byAFP - 67 words
-
432 1996-06-15 22 Leticia Perez - Leticia Perez Manila immigration 'unable to enforce govt ban' By in Manila FILIPINAS are still making a beeline for Singapore to work as maids despite a government order banning the deployment of maids to the island. Philippine airport immigration has been unsuccessful in enforcing432 words
-
REGIONALFILE
-
Article72 1996-06-15 22 Indonesian Interior Minister Yogie Suardi Memet will open a five-day congress called by dissidents of the opposition Indonesian Democratic Party in a bid to oust its current leader Megawati Sukarnoputri, local media reported yesterday. The official Antara news agency said the congress, condemned by Ms Megawati as illegalReuter - 72 words
-
Article70 1996-06-15 22 Thailand's air-force chief has said a deal to buy US jet fighters from the United States included advanced air-to-air missiles despite initial US reservations about supplying the weapons to the region. Air force commander-in-chief Air Chief Marshal Siripong Thongyai told reporters on Thursday that a letter of acceptanceReuter - 70 words
-
Article79 1996-06-15 22 The Asian Development Bank said yesterday that it has approved technical assistance of US$BOO,OOO (Ssl,l million) to the former US naval base of Subic Bay, which will host a summit of Pacific Rim economies in November. The grant will be used to design an urban infrastructure improvementAFP - 79 words
-
Article74 1996-06-15 22 Myanmar troops and their allies fired a dozen mortar bombs into a refugee camp on the Thai side of the frontier, wounding three people and sending hundreds fleeing in panic, a Thai army source said yesterday. The attack on the Shokhlo refugee camp in northwestern Thailand, home toReuter - 74 words
-
Article44 1996-06-15 22 Chinese-Filipino tycoon Lucio Tan is emerging as the winner in the contest to control Philippine Airlines, The Asian Wall Street Journal reported. Mr Tan will sign an agreement soon with the airline's government shareholders, giving him a 57-per-cent share, it said. BloombergBloomberg - 44 words
-
Article45 1996-06-15 22 A cholera outbreak struck the B'laan tribe in the southern Philippines, killing two people and infecting 59 others, but the disease has since been contained, the Health Department said yesterday. The May l to June 7 outbreak took place near the town ofTupi. AFPAFP - 45 words
-
-
-
Page 20 Advertisements
-
Advertisement331 1996-06-15 20 (V C J /T 7 ALL ITEMS WHILE STOCKS LAST! r P a,,ti=* 9 IF k. 0* ta*£ Kitchen Towel 6 Rolls I HK COMFORT 2L J| JS y>^ >^ B Buy 2 Get 1 FREE^r;*^ > s£j|g|| JL/ 1 *A &^%qc iy^ LOTUS I H Lotus Compact /£osr k331 words
-
-
Page 21 Advertisements
-
Advertisement477 1996-06-15 21 I >/ s v_necKeQ snirt ■j&w Ik' b I Lju^—ii^j '?'"""#■> j^K <^Bjf Bp^/ > i\ ceo m for the above brands. (A sst. Designs) !>// $59.90 i \^B --^r" V^ I ■"■"■P^--' ■^^■*****81 H^^VJMmP|HB Privateer Game j $95.00 Elle Babies, 1^ \s^* 'f^T D r\ kr» ft* Bf'T f^L477 words
-
-
Page 22 Advertisements
-
Advertisement1297 1996-06-15 22 HT-II FRASER AND NEAVE, LIMITED UM. flf^l (Incorporated in the Republic of Singapore) RESULTS FOR THE HALF YEAR ENDED 31 MARCH 1996 The directors are pleased to announce the unaudited results for the half year ended 31 March 1996:- QBQUP COWWMIY 1996 1995 Change 1996 1995 Change A. PROFIT STATEMENT1,297 words
-
Advertisement879 1996-06-15 22 CENTREPOINT PROPERTIES LTD (Incorporated in the Republic of Singapore) RESULTS FOR THE HALF YEAR ENDED 31 MARCH 1996 The directors are pleased to announce the unaudited results for the half year ended 31 March 19%:CROW COMPANY 19% 1995 Change 1996 1995 Change SSM S$M SSM SSM A. PROFIT STATEMENT Turnover879 words
-
-
MALAYSIA
-
430 1996-06-15 23 Ho Wah Foon - Ho Wah Foon Development plans will be presented to ministers for adoption next week P* in Kuala Lumpur SENIOR officials of Asean and Mekong states finalised a concept paper on the comprehensive development of the Mekong basin when they met on the first day yesterday.430 words
-
MALAYSIAFILE
-
Article59 1996-06-15 23 Wet weather conditions would prevail in the west coast and central Peninsular Malaysia over the next week, Meteorological Department deputy director-general Dr Lim Joo Tick said in Kuala Lumpur yesterday. He said the rainy weather was caused mainly by the abnormal pattern of the South-Westerly Monsoon which beganBernama - 59 words
-
Article69 1996-06-15 23 Greater care and rehabilitative services for the aged and better community support systems will be needed in view of the expected increase in the number of elderly 25 years from now, according to the Director-General of Health. TanSriDrAbußakar Suleiman said in Kuala Lumpur on Thursday that Malaysia wouldNST - 69 words
-
Article67 1996-06-15 23 Several oil companies had agreed to pool their resources and acquire equipment to fight oil spills in waters of Terengganu, the state government said yesterday. The oil companies would be acquiring the equipment at a cost of MsB million (554.5 million) and store it at Kemaman Port, StateBernama - 67 words
-
Article49 1996-06-15 23 A cow elephant which had left a trail of destruction in oil-palm estates was shot dead near the Sekolah Kebangsaan Langgar school in Hulu Terengganu on Thursday. "Wehadtoshoptit dead before anything untoward happens to the public." said Terengganu Wildlife and National Parks Department director Saharudin Anan. BernamaBernama - 49 words
-
Article57 1996-06-15 23 Four robbers clad only in their briefs robbed a family of M53,500 (551,960) in cash and jewellery in their house in Taman Eagan, Penang on Thursday, according to The Sun. The newspaper reported that the robbers, who had their faces covered with cloth, tied up the houseowner and57 words
-
Article57 1996-06-15 23 A suspected road thug who was arrested on Wednesday for allegedly assaulting a salesman and his family has been remanded for seven days by the magistrate's court The Star yesterday quoted Sentul district police chief Assistant Commissioner J. R. J. Raj as saying that the suspect, a carpenter,57 words
-
-
205 1996-06-15 23 Cancer 'still there despite ATC doctor's assurance' PETALING JAYA Another cancer patient who underwent the autologous target Cytokines (ATC) treatment is still suffering despite a Singaporean doctor's assurance that he has recovered, according to The Sun yesterday. "We were led to believe that my uncle had recovered when the doctor205 words
-
Article, Illustration369 1996-06-15 23 KUALA LUMPUR The Malaysian government wants to encourage the private sector to build more budget hospitals in the country, especially in smaller towns, to make health care more affordable. The Sun yesterday quoted Health Minister Datuk Chua Jui Meng as saying369 words
-
Article, Illustration595 1996-06-15 24 Ho Wah Foon - Ho Wah Foon By 1/ in Kuala Lumpur On effects of investment policy 'While waiting for better times, we have meanwhile lost our land rights, ethics, peace, and day by day we lose our honour.' On Domestic Violence Act 'With595 words
-
175 1996-06-15 24 KUALA LUMPUR Parti Melayu Semangat 46 Youth wing wants its president Tengku Razaleigh Hamzah to sue PAS information chief Abdul Halim Abdul Rahman for allegedly defaming its leader. Mr Halim, who is also Kelantan First Deputy Mentri Besar, was quoted by Utusan Malaysia175 words
-
Article, Illustration288 1996-06-15 24 KUALA LUMPUR— Customs officer Masran Basri.who was injured during a robbery last November, is paralysed and unable to speak. He has been in this condition since the day a robber I rammed the car he was driving with three other officers while onBernama - 288 words
-
205 1996-06-15 24 KUALA LUMPUR Another wife of former Al-Araam leader Ashaari Mohamad, Tengku Noriah Tengku Abdullah, has been detained in connection with activities to revive the banned movement. Police sources said Tengku Noriah, 38, was picked up from Ashaari's house in Rawang by a teamBernama - 205 words
-
204 1996-06-15 24 University stands by river pollution findings JOHOR BARU Universitl Teknologi Malaysia (UTM) has defended the results of its studies on pollution levels in rivers in the Johor Baru district, saying that they are accurate. The Sun yesterday quoted UTM environmental research institute chairman Professor Mohd Zulkifli Mohd Ghazali as saying204 words
-
-
Page 23 Advertisements
-
Advertisement276 1996-06-15 23 ■——■I II ISS The National University I \roS/ of Singapore I Founded 1905 ADMISSION TO POSTGRADUATE COURSE MASTER OF SCIENCE (Computer and Information Sciences) Applications are invited for admission to the Master of Science (Computer and Information Sciences) course to be conducted in Semester II of the academic year 1996-7.276 words
-
Advertisement308 1996-06-15 23 I CARPET GALLERY PTE LTD I jgHBS JM M 1 •"I I ik^ _r^ ~w% _c_ t B^_ r 9_m_Lj I i i titnYifWjOft VI refill I fii^ in i in i If Display Unit M Assorted Designs ___H______. Now Only: FROM $999 t[ |f 9^ iICttSSO WB^BBaSEBmBmBBmSESBmSm mm Genuine308 words
-
-
Page 24 Advertisements
-
Advertisement328 1996-06-15 24 L^^^ Q/vew q^ 'tween Wr Condominium Townhouses with facilities in T Singapore's East Coast, Kew Drive 1 as _^s bl m |h zv i< |h Ib^C BBBBBBBBg^^H^^^^Kgfl B^BM I^Bbu. "*^j^B^B B^v SKEWI Kew Green offers tne comforts and prestige of landed HB«HBjBBBBBjBBBBBBBBjHM| |fejß|^J property combined with the luxuries and facilities328 words
-
-
HOME
-
531 1996-06-15 25 M Nirmala - M Nirmala Good grades alone are not enough for new NUS talent development programme By We feel that a good mind is a terrible thing to waste. If you dare to dream, come to this programme. There are a lot of things waiting for you,531 words
-
Article202 1996-06-15 25 AROUND 1979, Dr Tan Yit Beng dropped out of the National University of Singapore in his first year but was later saved by his mentor, a lecturer. In the end, he secured a place in the prestigious American university, the Massachusetts Institute of Technology (MIT) where he202 words
-
Article, Illustration461 1996-06-15 25 Chong Chee Kin - Chong Chee Kin By FROM a motley bunch of rejects from other Extra-Curric-ula Activities, the Queenstown Secondary School band has grown into a tight disciplined unit, who will go to Sarawak this weekend to raise funds. The man responsible for (his transformationALPHONSO CHAN - 461 words
-
197 1996-06-15 25 THE National Trades Union Congress (NTUC) has commissioned several television productions, including a Mandarin drama serial, to give an insight into the role of the trade union movement here. This was reported in the latest edition of its weekly newsletter, NTUC News. The197 words
-
Household Expenditure Survey 1992/1993
-
Article, Illustration563 1996-06-15 26 Jason Leow - Jason Leow TVs, refrigerators and phones owned by most people By THE Household Expenditure Survey was carried out in two stages. In the first stage, data, collected from 8,452 households, which formed a sub-sample of the 1992 Labour Force survey, was collected. In theTimesgraphics - 563 words
-
-
297 1996-06-15 26 THREE per cent of all households owned a second property in 1993. Breaking down this finding, the survey found that about 8 per cent of households living in bungalows and terrace houses owned a second private apartment or condominium, and about297 words
-
OTHER FACTS AND FIGURES
-
Article68 1996-06-15 26 HOUSEHOLDS in which the main income-earner has a university degree spent an average of $5,966 a month. At the other end of the spectrum, homes where the main breadwinner has no education spent an average of $2,026 monthly. Households where breadwinners have primary education spent68 words
-
Article49 1996-06-15 26 The average monthly spending of households living in bungalows and terrace houses was $7,036, whereas that for private flats was $6,230. For HDB flats, one- and two-room households had monthly bills averaging $1,347, three-roomers had bills of about $2,050, and other flats had expenditure of $3,173.49 words
-
Article46 1996-06-15 26 As Singaporeans grow richer, more are hit by the travel bug. Holiday expenses formed the largest share of miscellaneous spending for all households. It ranged from 27 per cent for public flat-owners to 43 per cent for those living in private houses.46 words
-
Article69 1996-06-15 26 Pianos and organs are still uncommon in Singapore. In 1988, 11.4 per cent had either instrument, and this rose marginally to 11.8 per cent in 1992. Not surprisingly, most of the pianos were found in private homes. About 42 per cent of bungalows and terrace69 words
-
-
590 1996-06-15 26 Walter Fernandez - Walter Fernandez By THE Singapore Democratic Party (SDP) and the Singapore Malay National Organisation (PKMS) yesterday released a joint report arguing that the cost of living in Singapore has increased faster than wages. The SDP-PKMS Cost of Living Report 1996 outlined590 words
-
458 1996-06-15 27 No change in noodle prices for now, say manufacturers BREAD prices could rise in the wake of drastic wheat price increases because of bad harvests and high demand, manufacturers say. Noodle prices, however, should stay where they are now, unless wheat458 words
-
Article, Illustration235 1996-06-15 27 Fracas at bowling alley FRAYED tempers resulted in two TCS comperes and a 61--year-old man being charged in court for affray. Chan Hwa Peng, 61, Ong Siong Khim (Wang Xiangqing), 33, and Chwan Yi Fong (Quan Yifeng), 22, were accused of kicking each other,235 words
-
IN SHORT
-
Article61 1996-06-15 28 The chairman and chief executive officer of Caterpillar Inc, Mr Donald Fites, on Wednesday presented a cheque for $50,000 to Community Chest chairman Richard Eu. Mr Fites is in Singapore for the opening of the company's new training centre. Dr Eu said the donation would help the Chest61 words
-
Article146 1996-06-15 28 The Singapore Armed Forces will hold military exercises in Lim Chu Kang, Hong Kah, Marsiling, Mandai, Sembawang, Tampines, Upper Jurong, Jalan Bahar, Kranji, Seletar, Bedok Jetty and Tuas from 8 am on Monday to noon on Saturday. The Republic of Singapore Air Force will conduct live-firing exercises at146 words
-
Article, Illustration31 1996-06-15 28 Do you know this man? If you do, phone the Singapore General Hospital on 321-4886. He was found with head injuries on March 1 and sent to the hospital.31 words
-
Article82 1996-06-15 28 Guess which country will bag the most golds at the Atlanta Olympics this year, and win handphones and special MobileLink packages. From today to July 15, Singapore Telecom MobileLink will be organising the Olympic Champions Contest. To qualify for the lucky draw, call 691-1055 and key in your82 words
-
-
Article, Illustration294 1996-06-15 28 MOMENTS after its birth in the aquarium at the Underwater World, a baby blacktip shark escaped being eaten alive by other sharks and became the first baby shark of its kind to survive here. It was found in a holding tank connected to theALPHONSO CHAN - 294 words
-
590 1996-06-15 28 But sometimes visits must be supervised The parent has molested the child or has been in an incestuous relationship. He has injured the child badly because of his violent nature. The parent's influence is so strong that the child would590 words
-
Article, Illustration443 1996-06-15 29 Mum who gave part of liver to son A TEAM of five surgeons assisted by two anaesthetists, a paediatrician and a host of nurses cut out the left lobe of Madam Poh Siew Kuan's liver and transplanted it into her 19-month-old son,Timesgraphics - 443 words
-
322 1996-06-15 29 New standard maid employment contract ANOTHER 55 maid agencies here have accepted the new standard employment contract set out by the Philippines Embassy a month ago. This brings to 115 the number of Singapore maid agencies accredited by the Philippine Overseas Employment Administration322 words
-
Article, Illustration474 1996-06-15 29 Tan Hsueh Yun - Tan Hsueh Yun Mass display at National Day Parade will entertain and surprise By ONE minute, it is a ship, complete with sails. The next, it transforms into huts, and then a two-storey shophouse. This is how the action will unfold in the mass drama segment ofTAN SUAN ANN - 474 words
-
-
Page 25 Advertisements
-
Advertisement522 1996-06-15 25 M A M HA Jfl HL Mi I A M ■.I'l BNj RP X^X**! I L&S I <*<>" product, or. avoilobl.oto!l WHY PAY MORE? oud.h, fflV hblßbbhlH Bhmbßl RBRRVBRMRaURH mKmmmmmmmmmKmKmMm^^mmmmmmmmmm .xc.pt An fl m o kk>, e^ok. chmotow* p«nt Hoiiond v,iio 9 W M m t rubok %R^nrpTpri i rnn522 words
-
-
Page 26 Advertisements
-
Advertisement335 1996-06-15 26 IEBMf K'-''-' TMMYOH* y^^ want my friends ttSKm 270n78 g j m N m Vto reach me for parties J mKm fl m X. *****18 *****51 H^. fl IfctthiZ^^^ '^W ttc^wmwGM^we CHALLENGE Ift Ol *****05 I I fcs |J SAVE $20 S y *****69 B»_, B^ if R| A I335 words
-
-
Page 27 Advertisements
-
Advertisement353 1996-06-15 27 f PACIFIC OCEAN ACCESS W^g SINGAPORE OWNED DEVELOPMENT i Australia's newest WATERFRONT integrated residential resort Gold Coast Australia J^^^^^^blbplS9v fIHE BJ^t^B^^LJß^bl BPvaP^Kbßbl g^j J^BßVßlßßi^^^^^B^^^^^Cd^nVj^lCc^M ZbBjV9G^S)vVI t FBJST STAGE Great investment opportunity House land packages 300 room hotel 18 hole golf course Ocean marina Shopping centre Holistic healing centre Private sandy353 words
-
-
Page 28 Advertisements
-
Advertisement480 1996-06-15 28 ~1 j)irect-Spray No-Holes Drilled -J I 5^5 RUSTPROOFING I I w^J^ DEVELOPED WIBSL from aerospace TJEt 1 TECHNOLOGY |^g|| L_^ Tuff-Kote Dinol, the world's largest rustproof er, is also the world's largest andforemost aerospace Corrosion Inhibiting System Specialist. ZZ N ew tooling, nozzles and materials developed by Dinol for aerospace480 words
-
Advertisement96 1996-06-15 28 lililll^llilllll^l^lM^Ht' liljl-l^l^l^l^t^l- I= l'-l"-lsi- 1= l^l^l 1= IM= I* I- I^l* I 5 l^l 1 l l*lJi-l^l^l*I^I-i^l l*l l*l^l f l F I^l^l*!*!*! 1 Large quantity of Afghanistan, Pakistan, Russian Kashmir Silk Carpets in various sizes on sale. Hurry down for the best selection! Your last chance to acquire quality96 words
-
-
Page 29 Advertisements
-
Advertisement64 1996-06-15 29 B B V BM n iK vl [9 BBk Hi i I3» w* w Im. IM \B wn v Sbb^?^Hi£SSSS^bk^bl Kv £i 1 BBBf AH j B9pfiSß(n r lit Hf fl^BfH VJ "^HiP^ fcpM A i Mr b! SH cssstsS HV SW S I I |Bff i BB' //111/ ofl64 words
-
Advertisement371 1996-06-15 29 S3 SI OPEN FOR SALE NOW OFF HOLLAND GROVE DRIVE SINGAPORE (HOLLAND ROAD) IHG^HV'!SnKiSfll^ 'f^ -ifflHßLsi^'j IiSWHKa 7 \C/f I fv \ouiMn7 ml r orG6n bolt slono Holland Grove is an exclusive development that consists of splendidly unique 3-storey Semi-Detached Bungalows and elegant 3-storey Detached Bungalows. Situated off Holland Grove371 words
-
-
INSIGHT
-
Article, Illustration2729 1996-06-15 30 Soaring property prices have sparked off much heated debate in jrecent months, with accusing fingers being pointed at foreigners, speculators, developers and the Government's land tender system. But what really are the key factors behind the price spiral in the last three years?2,729 words
-
OFF-THE-RECORD
-
Article115 1996-06-15 30 PRIME Minister Goh Chok Tong and his party were scheduled to go on a cruise through Norway's scenic fjords off the coast of Bergen during his recent trip to Scandinavia. But officials of the city, legendary among Norwegians as being windswept and rainy, feared that the115 words
-
Article87 1996-06-15 30 A PRESS conference with Singapore journalists was scheduled midway through the above-mentioned boat trip, to be held on the island of Fedje, set against the scenic fjords. But, given the cold weather, officials feared that conditions might be too chilly for a 30-minute session with the87 words
-
Article111 1996-06-15 30 PROFESSOR Hans Witzell, director of Sweden's Karolinska Institute, wanted to impress PM Goh and delegation when they visited the centre last week. So he rehearsed a short speech in Mandarin to welcome them to the institute, one of Sweden's leading research centres. His speech, in heavily accented111 words
-
Article100 1996-06-15 30 AT 81, scouring the obituaries is part of his everyday routine, said Mr S. Rajaratnam in an interview this week. "Nobody is immortal, you know," he laughed. "Nature will tell us when to go. But retirement has not exactly slowed down the former foreign minister.100 words
-
Article, Illustration189 1996-06-15 30 IT WOULD appear that Singapore Democratic Party MP Chiam See Tone is a man of simple pleasures. The Potong Pasir MP nas been swimming for the past 30 years or more to keep fit and is still at it. A Political Desk reporter bumped into189 words
-
-
Article, Illustration1165 1996-06-15 31 Chua Huck Cheng - Chua Huck Cheng Thinking Aloud THOSE days of thought activism when Singapore was part of Malaysia, the acrimonious Separation, and Mr Lee Kuan Yew's surprise revival of the issue 31 years later all these have a resonance when taken through the continuum of1,165 words
-
Article, Illustration1231 1996-06-15 31 Interview Are Singaporeans lacking in community spirit? Have they become more selfish as they become richer? Eliza Teoh broaches the issue with Dr Tan Ern Ser, 42, senior lecturer at the National University of Singapore, Department of Sociology. INSIGHT: In an interview with1,231 words
-
-
Page 31 Advertisements
-
Advertisement112 1996-06-15 31 m^^ ifr /< *^s S^k\ /A m^9 I J&fe**^ iC I M&F Since 1 980 9 Take advantage of low, low prices for the RMjaji finest fully imported European furniture such as Sofa sets, Dining sets, Bedroom sets, Occasional furniture as well as Lighting Jjgtfk and Decorative Accessories. Great Savings112 words
-
Advertisement146 1996-06-15 31 ROUND V^» ;v Qj I W/2 pcs Folding Chairs B SiRP^ I J^^^^wSSk RELAX j4Hß|^^^ <8"X28"X30" fLfnj BOOKSHELF g(fT&WI li wß6*^ Colour Grey, White, BUckifcwch. DOCUMENT M Hb^l UP$B5 DRAWER ICl^ SUEMNG-DOOR "^wwpgii^i^i^Kiid** KEYBOARD 9* I J I J I HSP 3-DOOR WARDROBE MIX /A WARDROBE V MHIMteJ 1 1146 words
-
-
COMMENT/ANALYSIS
-
The Straits Times
-
Article670 1996-06-15 32 IF personalities and programmes were all that mattered in politics, India could hardly have hoped for a more pragmatic government than the one that Prime Minister H. D. Deve Gowda heads. The problem lies in the numerous parties that make up the United Front (UF),670 words
-
-
Article65 1996-06-15 32 "At a sexually active age, women vote for me. And women in what do you call it, menopause? women in menopause vote for {President Boris) Yeltsin." Russian presidential candidate Vladimir Zhirinovsky, on his analysis of voting patterns. "1 think it would suit me fine." Triple Wimbledon tennis champion Boris65 words
-
Article, Illustration6 1996-06-15 32 TlfntSQri|Hiics; JOHNNY LIMJOHNNY LIM - 6 words
-
Article, Illustration1977 1996-06-15 32 When Senior Minister Lee Kuan Yew considered the question, the conditions and the wisdom of Singapore's future reunion with Malaysia in a guardedly favourable light, it caught many Malaysians by surprise. Bunn Nagara, a Malaysian media and political consultant, looks at the prospects1,977 words
-
Article477 1996-06-15 32 Reactions of Malaysian press to SM Lee's comments on merger The Malaysian media continued to react to Senior Minister Lee Kuan Yew's recent comments on the conditions for Singapore's merger with Malaysia, as this selection of excerpts demonstrates. Utusan Malaysia, June 14 (Column by Zin477 words
-
1230 1996-06-15 33 John Helmer - John Helmer Voter and 'dacha factor' may skew things By in Moscow The Yeltsin campaign has been professionally executed, with steady intensification of the message. But there is now evidence that people are getting sick of the amount of propaganda, and the1,230 words
-
Article, Illustration1082 1996-06-15 33 Tan Sai Siong - Tan Sai Siong A L^b^h E war^ _§y SUPPOSE Singapore were to rejoin Malaysia, under what terms would Singaporeans find it acceptable to do so? When the Senior Minister was asked this question last Friday at a dinner talk to the1,082 words
-
-
Page 32 Advertisements
-
Advertisement67 1996-06-15 32 HOW TO Newsdesk Tel: 730-5397 iiuwi iv Political Desk Tel: 730-5747 Fax:732-0131 REACH US ft™ I Tel: 730-5454 Sports Desk Fax: 735-0781 After office hours, Foreign Desk Tel: 730-5745 c 7 ,0« 9n please call China Desk Tel: 730-5622 733 4IZB operators at Money Desk Tel: 730-5471 Fax: 733-4517 737-00167 words
-
Advertisement121 1996-06-15 32 Hi Hi Hi f~s1 73,100 WITH LAND AND HOUSE YOU PAY NO MORTGAGE LOAN REPAYMENTS FOR 2 YEARS (After 35%Deposit) I PERMIT NO. ***** DEVELOPER PAYS i INVESTMENT PACKAGE FIRST 2 YEARS INCLUSIONS Bank Loan Repayments Excellent District Facilities Loan Guaranteed with No Proof of txcenent District hacmties Income Required121 words
-
-
Page 33 Advertisements
-
Advertisement228 1996-06-15 33 Imported Cow Hide Leather d— fcTHE GREAT »'«i»i««t Hie cfito*^ Juliet (3 2) Usual Price $3^ *JJ^. lea ther" M <O 000 /sen** ***** i: ANNUAL^ IIII^ I mLI MR 3360 (3+2) Usual Price $3^>42f I $3 4W Jl FA Brighton (3+2) Usual Price $3,045 Ij KBfl $2,299 I^^, Ml228 words
-
Advertisement116 1996-06-15 33 Canon BJC-21 0s Bubble Jet Printer $299.00 Microsoft Encarta 96 Encyclopedia 79.95 Microsoft Publisher for Windows 95 $1 29.95 Microsoft Encarta 96 World Atlas 79.95 I Wrong Answer $588.85 Find out more at our participating dealers: •Advance Gravis Computer Technology Pte Ltd Te1:338 6433 *Betts Marketing Services Pte Ltd Te1:792116 words
-
-
Page 34 Advertisements
-
Advertisement509 1996-06-15 34 m M m. MB JF m yl P^J While Stocks Last! 2 Pays Onlyl A P^^ AJH MB B^ Classic Chair Lounge Chair, Leather Italy /iki«_ 4| B^ o J i 4 I 1 0 tj S 'tit 9 I c T ;1 1 It fl laliHiiyMP' t 7 (f509 words
-
-
FORUM
-
393 1996-06-15 35 Making exec condo purchases easier will open flood-gates I FULLY agree with Lee Mui Lian's viewpoint published on this page on Thursday. If one wishes to live on a top floor with a panoramic-view roof garden, one should not ex- pect to393 words
-
Replies
-
Letter, Illustration174 1996-06-15 35 2 I REFER to the report "Men- tal maths: Set standards" (ST, June 10). 2 The report might have givfen the public' the impression I that the People's Association (PA) engages unqualified inS structors to conduct Abacus and Mental Arithmetic classes at174 words
-
93 1996-06-15 35 I REFER to the letter "Raise speed limits for all vehicles for smoother flow of traffic" (ST, June 10). Traffic Police would like to thank the writer for his valuable feedback. The writer's suggestions will be considered in E the on-going review of speeolimits93 words
-
312 1996-06-15 35 I WOULD like to take this opportunity to clarify the situation described in Mr Chua Teck Keong's letter "Why was Sublic pool reserved?'^ (ST, une 6). The Singapore Sports Council regrets any inconvenience caused to Mr Chua due to the reservation of the dementi312 words
-
-
358 1996-06-15 35 WHY IS Singapore constantly criticised by the Western media and intellectuals as being an authoritarian or a dictatorial society? This view of the country obviously arises from Senior Minister Lee Kuan Yew's strong leadership. If it is this strong leadership that358 words
-
102 1996-06-15 35 THE Upper Bukit Timah Road area has been earmarked by the Government for residential housing. The present traffic situation there, even without the completion of condominiums like Southaven, Springdale and Hume Park 11, 111 and IV, is already bad during rush hour and in102 words
-
-
Page 35 Advertisements
-
Advertisement760 1996-06-15 35 I At Dover Crescent, next to Singapore Polytechnic I DOVER PARKVIEW A luxurious seaview condominium that sets a new trend for 21st Century living with its intelligent home automation systems Built on high ground, with higher floors that command an excellent view of the buildings of Raffles Place and the760 words
-
-
Page 36 Advertisements
-
Advertisement1731 1996-06-15 36 \Jt^ BANK OF CHINA Singapore branc Mr Wußonoouo Vice Premie* of lifl II Mr. Fu Xuezhang. Ambassada M/SS^ MZMm* > Mr Wana Xuebin< \j- f*" *V' x: v* r) Mr. Zhou ZWgong, ♦V- BankofChinaSl Bank of China's overseas businesses. L*jrijS |^JriiiiVin:iiji JL__ijLjJ.J]iji_ M t4i^ JLUJL-i^- a ij^-^ J IJiJ— j-i1,731 words
-
-
Page 37 Advertisements
-
Advertisement1748 1996-06-15 37 Ce/ebrafina 60 years in Singapore HI M M 1936-1996 The SingajWK Branch, established in 1936, is one of the first few characterised by its solid foundation and rich experiences, will continue to The Singapore Branch, rooted in one of the international financial overseas branches set up by Bank of China.1,748 words
-
-
SPORTS
-
Article, Illustration580 1996-06-15 38 Tay Cheng Khoon - Tay Cheng Khoon S-League soccer result: Woodlands Wellington 2 Geylang United 2 Fandi's equaliser enough to seal title for Geylang By WOODLANDS 2 GEYLANG 2 Scorers Woodlands: Ervin Boban (35th), D. Devaraj (48th). Geylang: Chris Riley (25th), Fandi Ahmad (66th). Yellow cards Woodlands: Mohamed580 words
-
Article75 1996-06-15 38 P W D L F A Pts Geylang 14 9 1 4 27 14 28 Woodlands 14 8 2 4 25 20 26 Balestier 14 7 3 4 22 18 24 SAFFC 14 5 3 6 27 25 18 Tiongßahru 14 4 5 5 20 1975 words
-
Article, Illustration471 1996-06-15 38 Godfrey Robert - Godfrey Robert COMMENT by WHAT a match. What goals. What a finale to the S-League Tiger Beer Series. For 25 minutes, the title was in Geylang United's clutch, thanks to a Chris Riley 30-metre volley that bulged the Woodlands Wellington net. Within the next 10JERRY SEH - 471 words
-
Article, Illustration162 1996-06-15 38 Joe Dorai - Joe Dorai MAN OF THE MATCH IT WAS guts and determination, claimed Geylang United skipper Fandi Ahmad, that won his team the Tiger Beer Series soccer title with a 2-2 draw against Woodlands Wellington at the National Stadium last night. Woodlands Wellington's D. Devaraj was162 words
-
Article211 1996-06-15 38 Thomas Koh - Thomas Koh POST-MATCH CONFERENCE By MANY in the stands felt that Sandro Radun's poor game in goal cost Woodlands Wellington the Tiger Beer Series title, but Rams r coach Steve Wicks refused to blame his custodian. Said the Englishman: "Football is a human game. People make mistakes.211 words
-
Article, Illustration488 1996-06-15 38 Thomas Koh - Thomas Koh SATURDAY THE curtain has fallen on Singapore's first foray into professional soccer and most would agree that it has been a success. The Tiger Beer Series produced some splendid goals, drew good crowds and there was a thrilling climax to the title488 words
-
Article290 1996-06-15 38 FANDI AHMAD will have to wait another 14 more matches to see whether he is going to receive the Tiger Beer Golden Boot Award. For, contrary to what many players and fans believe, the award will be based on the number of goals scored in both the Tiger Beer290 words
-
THE LATE NEWS
-
Article102 1996-06-15 38 ROMANIA confirmed yesterday that it would be lodging an official protest to Uefa about the "goal" it scored, but which was not given, during its 0-1 Euro 96 Group B defeat by Bulgaria on Thursday. An official letter of protest was to have been handed to Uefa102 words
-
-
Article724 1996-06-15 38 BASEBALL National League: San Francisco 12 Houston 8, Florida 4 Pittsburgh 3, Los Angeles 6 Atlanta 3, Chicago 6 San Diego 3, New York 2 St Louis 1, Colorado 4 Philadelphia 1. American League: Boston 8 Texas 7, Cleveland 6 New York 2, Kansas City 10 Baltimore724 words
-
Article601 1996-06-15 39 GOLF: US OPEN BLOOMFIELD HILLS (Michigan) Former champion Payne Stewart and former bank teller Woody Austin shot three-un-der-par 67s on Thursday to share the firstround lead in the US Open golf championship. Stewart, the 1991 Open champion, survived a couple of "ugh/ holes in an up-and-downReuter; AFP - 601 words
-
Article, Illustration434 1996-06-15 39 BLOOMFIELD HILLS (Michigan) Amateur sensation Tiger Woods roared through the front nine but left the U.S. Open's first round like a lamb, plunging from the lead by going nine-over par on the last five holes at Oakland Hills. Woods went bogey, doublebogey, quadruple-bogey, bogey, bogeyReuter - 434 words
-
Article, Illustration513 1996-06-15 39 NBA Finals Game Five: Live on Premiere 12, 9am today SEATTLE Chicago stumbled off an unscheduled detour on a stroll down Coronation Street, but the Seattle SuperSonics has yet to show it has what it takes to swipe a championship. Seattle's 107-86 victory in game fourAFP; Reuter - 513 words
-
235 1996-06-15 39 MANILA Dennis Rodman's long-lost father says his son is "all right", and believes the outrageous personality of the "Worm" on and off the court is a form of revolt against racism. Philippines-based bar owner Philander Rodman, described by the mother of the NationalAFP - 235 words
-
203 1996-06-15 39 YACHTING About 100 lasers will take to the waters off Europa Sailing Club in the annual Singapore Laser Trophy today. Sailor Ben Tan, who has been away for much of the year preparing for the Atlanta Olympics, will be competing. Besides the Asian203 words
-
Article, Illustration574 1996-06-15 40 Was referee Mikkelsen right or did Munteanu's attempt cross the Bulgarian goal-line? *What is astonishing is that the referee didn't consider it necessary to consult the linesman. I'm amazed the officials didn't bother to discuss it' Romanian captain Gheorghe Hagi. NEWCASTLE It wasReuter - 574 words
-
Obituary, Illustration107 1996-06-15 40 VELLASAMY PMaod away peacefully on 14.6.96 leaving behind: Beloved Wife: Mdm Kannayirarn '.Son: V. Shanmugam Daughter*: V. Chandra Devi V. Janaki V. Tamillarasi Sons-in-law: •> Muniandy Raja A. Michael P. Renganathan OrandchHdr.n: M. Vimala M. Parthiban Agnes M. Linda M. Relatives ft Friends to mourn for him.107 words
-
Double Dutch delight
-
Article, Illustration395 1996-06-15 40 Cruyff's goal pure piece of magic 1 needed it very badly and the team needed it, too/ Jordi Cruyff. 1 knew him from my stay in Spain. I was full of confidence that he was able to play at this level/ Dutch coach Guus Hiddink on Jordi Cruyff. BIRMINGHAM JordiReuter - 395 words
-
323 1996-06-15 40 Bergkamp winner ends 14-month drought BIRMINGHAM When Dennis Bergkamp struck the clincher in the 79th minute, it was only his second international goal in 14 months. But it could not have come at a better time. Not only does it almost ensure the Dutch a place in the quarter-finals, itReuter; AFP - 323 words
-
-
Article, Illustration632 1996-06-15 40 Wilfred Yeo - Wilfred Yeo RUM Of MAY By FIFA keeps talking about fair play, but the irony is that the very official assigned to maintain fair play on the soccer pitch fouled it up on Thursday. Danish referee Peter Mikkelsen missed Dorinel Munteanu's632 words
-
COMING UP NEXT
-
363 1996-06-15 41 LEEDS Spain and France look set to give free rein to their attacking skills when they clash in Euro 96 group B today (tomorrow morning, Singapore time) a repeat of lie 1984 final. The Spanish, having scraped a l-l draw with Bulgaria, need allReuter - 363 words
-
Article404 1996-06-15 41 Holland 2 Switzerland 0 gfhgfh BIRMINGHAM Holland all but ensured its passage into the quarter-finals with a 2-0 win over Switzerland in a Group A match on Thursday, with late goals from Jordi Cruyff and Dennis Bergkamp. Cruyff gave the Dutch the lead in the 66th minute when he hitReuter - 404 words
-
Article, Illustration651 1996-06-15 41 Several club-mates on opposite sides as England faces Scotland picture LONDON Far more is at stake than the settling of old scores when the ancient rivalry between England and Scotland is revived at Wembley today after a seven-year gap' While both sets ofReuter; AFP - 651 words
-
Article561 1996-06-15 41 Roger Wright - Roger Wright Coach-to-be will have easier job assembling 1998 World Cup team By What Steve Wicks says 'Against Switzerland, England seemed to forget the parts of the game that helped Scotland draw with Holland passion and work-rate. I would like to see Paul Gascoigne take561 words
-
Article, Illustration213 1996-06-15 41 LONDON Goals continue to be in short supply in Euro 96. Bulgaria's 1-0 defeat of Romania and Holland's 2-0 victory over Switzerland on Thursday took the total to just 16 after 10 games. Hristo Stoichkov, one of the deadliest marksmen in the business, ended Romania'sReuter - 213 words
-
388 1996-06-15 41 'Tartan Army' sets out for Wembley GLASGOW From Aberdeen to Auchterarder and Kilmarnock to Kyle of Lo L chalsh, Scottish soccer fans began the great trek south to England yesterday for a long-awaited meeting with the "auld enemy". For many Scots, the aor nual match with England was the highReuter - 388 words
-
Article389 1996-06-15 41 Bulgaria 1 Romania 0 gdfgg NEWCASTLE Bulgaria edged Romania out of the European Championship when a third-minute Hristo Stoichkov strike went unanswered in a Group B tie on Thursday. Romania, which provided so much clever ana expressive attacking play while its opponent sat back in a defensive posture relying onlyReuter - 389 words
-
-
-
Page 38 Advertisements
-
Advertisement201 1996-06-15 38 ■Bb^^~~^^^^bß Mk B* •J TAMPWES MALL, 2ND LEVEL jglgfljg^GQLf SECTION TEL: *****77 EXTN2I4^j JAPAN M-D-DOYA WKUNOXR 9 (OVERSIZE) TITANIUM 1 00% Graphite Shaft) 3 wood 9 iron HEAD IRONS Usual $2200 NOW: 1 1 00 FREE GOLF BAG MIZUNOCHIME-i LADIES SHm 1 00% Graphite) 3 wood 9 iron m Usual:201 words
-
Advertisement134 1996-06-15 38 Next Draw No. 1066/96 Monday, 17 June 1996 Group I Prize $808,000. Group II Prize $228,000. WINNERS FOR DRAW NO. 1084AM Group I Prize: $316,974 No Wlniwcs Group II Prbw: $147,054 5 Winners Shared EquaKy Sold at: 1) Whampoa Tat Lee Trading, 865 Mountbatten Road, Katong Shopping Centre #01-26(OneQuickPk* System134 words
-
-
Page 38 Miscellaneous
-
Miscellaneous71 1996-06-15 38 TODAY'S EVENTS I BOARDSAILING Mark Tan Cup (PA East Coast SSC, 2.30pm) FENCING National Individual C'ships (Clementi Sports Hall, 2.30pm). HOCKEY SHF Div 2: Dutch Club v Safsa (3pm). Women's League: SCC v CSC (4.30pm), Jansenites v Dutch Club (6pm), SRC v Police (7.30pm) Delta SC. NETBALL National Mixed Carnival71 words
-
-
Page 39 Advertisements
-
Advertisement637 1996-06-15 39 ZAGRO ASIA LIMITED (Incorporated in the Republic of Singapore on 21 September 1 994) Invitation in respect of 25,000,000 New Shares of $0.05 each comprlsing:--(I) 19,000,000 Offer Shares at $0.51 for each Offer Share by way of offer; and (ii) 6,000,000 Placement Shares at $0.51 for each Placement Share by637 words
-
Advertisement209 1996-06-15 39 IURA FINAL ItDH GAME 5 Chicago Bulls v Seattle SuperSonics calli 900-91 2001 2 After 12 noon today Cost: .30 cents a minute (additional 1 0 cents a minute surcharge for cardphone access) m^b^bvlliJw >♦ *IL 31 MATCHES i all all ft ft •—3fc v most illustrious JHp^^H stadiums in209 words
-
-
Page 40 Advertisements
-
Advertisement70 1996-06-15 40 IgSBSSSI THE OFFICIAL SPONSOR FOR EURO '96 &«Tfl96§ ■iPXI official beer England They who think that you are gone, Because no more your face they see, Are wrong for in our hearts you live; And always will, in memory. V If "In Memoriam" Is for the loved ones whom you70 words
-
-
Page 41 Advertisements
-
Advertisement10 1996-06-15 41 tggSJBJS 7W OFf/C/4i SPOWSOI? FOff EURO sßUnij6® OFFICIAL BEER Enrdarul10 words
-
-
RACING/SPORTS
-
337 1996-06-15 42 Malcolm Bastians - Dismal support from trainers for rookies' series Malcolm Bastians By WHEN it comes to supporting their apprentices in a series tailored tor them, trainers on the local circuit have been disappointing. the first race slated for apprentices only after more than 20 years at Kuala Lumpur next week has attracted337 words
-
Article, Illustration447 1996-06-15 42 Danny Khoo - Danny Khoo RACING By PROFESSIONAL steward John Schreck bade farewell to local racing yesterday, somewhat disappointed that he had to cut short his stint with the Malayan Racing Association. The Australian turf lawman, who left for his Sydney home yesterday evening, still had about two447 words
-
Article143 1996-06-15 42 JOCKEY Asogan Thangaraju has failed in his appeal against a 12-month disqualification following a hearing in Ipoh on Monday. The 29-year-old rider copped the ban for his handling of Regency 11, who finished a head behind winner Uninhibited at Penang on May 11 in143 words
-
332 1996-06-15 42 IPOH Zaakho, looking in superb condition, wrapped up his preparation for the Class 2 Div 1 2,000m event in Race 7 tomorrow with a tworound workout yesterday. Taken out by a track rider, the seven-year-old New Zealand-bred gelding cantered one round and then followed upNST - 332 words
-
Article, Illustration269 1996-06-15 42 Thomas Koh - Thomas Koh gfgdfgdf By THBclock will be turned back this evening at the Bedok Sports Hall when former badminton greats Lius Pongoh and Foo Kok Keong take on each other in a special exhibition match. The clash will commemorate the grand finals of the Singapore269 words
-
Article117 1996-06-15 42 ENGLISH RACING LONDON Champion jockey Frankie Dettori will miss Royal Ascot after breaking his left elbow in a parade ring accident at the Newbury races on Thursday. The horse he was partnering in the fourth race reared over backwards suddenly and Dettori's elbow took theReuter - 117 words
-
Article1931 1996-06-15 42 GOING FORECAST: YIELDING TO SOFT [Res Terms Div 2 1 ,400m (SQ| Stakes $20,000 1 "0 Simply Historic 11 12 (4nzgSH Tan-Easy) Yeap 57 2 45-- Bay Of lightning 6 (3agßNg-SL) KWTan 55.5 3 Charleroi 4 (3nzg Tan SH-Auric) 'Saravanan c3 55.5 4 -0-6 High Speed1,931 words
-
Article228 1996-06-15 42 RONTEO DANNY MALCOLM MARC TAN KHOO BASTIANS 7Mr Personality i2N.BIue 12N.Bhw 12N.BIue 1 12N.BIue 7Mr Personality 7Mr Personality BR. Swallow m >«^ 8 R. Swallow 3Charleroi 11 Derby Chief 3Charteroi 14 Awakening Star 3RembauStar 3RembauStar 14 Awakening Star 2 13BoldBimiwi 13BoldBimiwi 13BoWBimiwi 13BoWBimiwi 6Kudadin 12 High Noon 14228 words
-
Article54 1996-06-15 42 3\ 1 IJ»«M Ist 2nd 3rd Ist 2nd 3rd Brink 30 18 19 Seow 16 7 19 Baertschiger 29 27 24 PK Leong 14 17 22 Thwaites 21 18 18 M Breukelen 14 9 7 Leek 19 8 10 BAng 14 6 9 Balfour 16 13 16 Yeoh54 words
-
Article64 1996-06-15 42 Rides Ist 2nd 3rd Rides Ist 2nd 3rd ,1,1 Chavez 242 46 43 26 Saifudin 170 17 9 15 LCropp 219 32 23 24 Slime 65 15 5 9 lAzhar 232 21 28 26 Kway 100 13 13 9 Woodworth 151 19 13 16 SYUong 101 12 1764 words
-
Article624 1996-06-15 42 1.30 RACE 1 2YO D2 1200m (LC) 1 Princess Fury (1) 'Ravi 55.5 2 Andy's Polly (4) Cropp 53.5 3 AceMcCloud(7) Saifudin 52 4 As If By Magic < 10) *Woodworth 52 5 Frank's Knight (5) *SHLee 52 6 Ipoh Tycoon (6) Wan 52 7 KiverGrosvenorO)624 words
-
-
Page 42 Advertisements
-
Advertisement23 1996-06-15 42 Horse Racing Results 1900-911-0001 available 1 hr after the last race 4Dflbto/Sweep 1900-911-0002 Cost: 50 cents a minute ■Mine An SPH AudloTex Service23 words
-
-
MONEY 6
-
Article354 1996-06-15 43 Friday^une 14 HK$ ASM Pacific e.BO unch AHJ^Jn^'nfl 0.42 unch AlUedOversea 0.«2 +002 Asia Int 1.51 jqM Bankot€A 27.80 0.06 C.P Pokphand 3.27 -0.02 GDI. HOW 4.22 +0.02 CafitpeCorai 2.16 -002 CathhieAlr 13.86 unch CtntwyClty 1.72 -0.08 ChtungKong 54.78 -0.26 China-Light 35.50 unch Chin* Motor But 72.25 unch Chinese354 words
-
Article396 1996-06-15 43 FrMaydune 14 YEN AdvarttestCorp 4790 -10 Ajinonwto 1310 +50 Akai gSctric 525 +10 Amada>. 1150 10 AsahiChemlnd 796 -3 AsahiGlass 1320 -1-10 Bank of Tokyo 1590 BridgJstone 1970 +30 Canort 2250 -20 Cask) 1 1040 unch CHteeh 924 +5 Dai Nibpon 2020 unch DaMchi Kangyo 2010 30 Dalai 1290396 words
-
Article204 1996-06-15 43 Friday. June 14 1996 Rubber Futures (Prices at 5.30pm) RSSI Contract Tonnes (Scents/kg) ».75 ftS* S 20.00 203.50 202.50 600 2050 OcW 197.00 ***** RSS3Contract (UScentykg) *J96 146.25 145.75 146.00 1610 2055 Aug 142.00 100 3720 Sep 140.00 3475 OcW 138.50 138.50 137.50 75 ***** Jan/Ma^97 137.00 900204 words
-
OVERSEAS MARKETS ROUND-UP
-
138 1996-06-15 43 TOKYO share prices rallied yesterday with the key market barometer closing 0.9 per cent higher on institutional buying of blue chips despite massive losses disclosed by Sumitomo Corp. Brokers said Sumitomo's announcement of a US$l.B billion loss in unauthorised copper trading was absorbed wellAFP - 138 words
-
Article107 1996-06-15 43 MILD buying led by gains in utility Tenaga Nasionalpushed Malaysian stocks to a higher finish, but activity remained muted with players on holiday and caution over local and US interest rates. News of a favourable power purchase pact price lifted shares of Tenaga, and provided encouragement for otherReuter - 107 words
-
Article63 1996-06-15 43 SHARE prices closed barely lower in cautious trading yesterday to end the week with six consecutive losses. "Most investors were sidelined in the absence of fresh incentives ahead of a long weekend," said a dealer at Sun Hung Kai Securities. The market closes on Monday for a public holiday.AFP - 63 words
-
Article39 1996-06-15 43 AUSTRALIAN share prices ended 0.7 per cent higher vesterday, recovering some of the ground lost on Thursday when the market fell to its lowest level in three months. The leading All-Ordinaries Index gained 15.6 points to 2,216.2. AFPAFP - 39 words
-
Article80 1996-06-15 43 LEADING European stock markets all lost ground on Thursday, the declines ranging from a slight 0.05 per cent in Frankfurt to 0.52 per cent on the Paris bourse, hurt by a weak bond market. The London stock market suffered a mild setback as operators feared a downward revision inAFP - 80 words
-
Article49 1996-06-15 43 SHARE prices closed sharply higher in active trading yesterday on a technical rebound in "large-cap" stocks. However, they said the rebound is not likely to be sustainable as investors are still cautious about political developments and upcoming IPOs. The Jakarta Composite Index rose 10.84 points to 592.36. AFX-AsiaAFX-Asia - 49 words
-
Article32 1996-06-15 43 SHARE prices on the Thai bourse rose 0.7 per cent yesterday due to a late rally on heavyweight issues. The Stock Exchange of Thailand Index gained 8.99 points to 1,256.04. AFPAFP - 32 words
-
Article107 1996-06-15 43 BLUE-CHIP share prices slumped on Thursday on prof-it-taking despite an improvement in what had been a gloomy bond market The Dow Jones Industrials Average fell 10.34 points to 5,657.95. Some 382 million shares were traded on the New York Stock Exchange, as losers outpaced advancers 1,335 to 929.AFP - 107 words
-
-
Article529 1996-06-15 43 Mgrs' prices, June 17 Singapore Unit Trust The Commerce 1.67— 1.77xd® The Savings Fund 1 .64— 1 .74® S'pore Prog Fund 0.70—0.74® S'pore Sec Fund 1.04—1.10® S'pore Invest Fund 1.11— 1.1 7xd« S'pore Equity Fund 0.81-0.86® Credit Lyonnais Infl Asset Mgt CL Asia-Pac Gr Fund 0.875-0.920* CL S'pore529 words
-
Article37 1996-06-15 43 June 14 Change KL Composite 1125.48 +3,86 Hang Seng *****.99 —1.03 Nikkei Average *****.39 206.99 Australian Ali-Ord 2216.20 +15.60 Dow Jones {Thu) 5657.95 —10.34 FTSEIOOfThu) 3761.70 -7.50 Jakarta Composite 592.36 10.84 Thailand SET 1256.04 8.9937 words
-
CURRENCY
-
Article140 1996-06-15 43 Singapore dollars to one unit of foreign currency Buying OD Selling US dollar 1.3974 1.4134 Sterling pound 2.1263 2.1788 Australian dollar 1.0679 1.1220 Canadian dollar 1.0143 1.0379 NZ dollar 0.9258 0.9575 EC unit 1.7559 Singapore dollars to 100 units of foreign currency Austrian schilling 12.7615 13.3271 Belgian franc140 words
-
Article26 1996-06-15 43 Open Close USS/DMK 1.5263 1.5244 USS/Yen 108.60 108.30 USS/SS 1.4083 1.4079 USS/HK$ 7.7417 7.7438 As/US$ 0.7900 0.7868 f/US$ 1.5350 1.5364 Source: Exco fiP Spore26 words
-
-
Article103 1996-06-15 43 Contract date: June 14, 1996 CURRENCY IMTH 3MTH 6MTH 9MTH 12MTH CALL VALUE DATE US$ 4% 5 svi 5m sv* Av* 18/6/% A$ 6% 6% 7 7 7v* 5% 18/6/% NZ$ 8% 9V4 9v* 8% BV4 7% 18/6/% STG 5 svi 5 5 5 4% 18/6/% JY103 words
-
Article2741 1996-06-15 43 Transaction Date: June 14, 1996 1096 Last Vol Nat High Low Company Sal* (000) P/E INDUSTRIALS Consumer Products 960 560 Ajlnomoto 680 unch 10 48.6 350 240 Angkasa 316 unch 25 15.6 100 150 Berjayalnd 162 -2 70 55.0 262 211 Beriaya Leisure 232 1 237 33.1 3122,741 words
-
Article34 1996-06-15 43 Crude palm ol (Ms/tonne) Jun 1150 (south) Refined palm oil (US$/tonne) RBD Palm Oil Jul 490 (seller) Aug/Sep 485 (seller) RBDOtein Jul 527.50 (seller) Aug/Sep 520 (seller) RBD Stearin Jun 385 (seller)34 words
-
Article11 1996-06-15 43 Closing prices (Ms/klk>) KLTm $15.36 (+$0.00) Turnover 70 37 tonnes)11 words
-
Article18 1996-06-15 43 Closing prices (US$/troy 02) Fri Thu Singapore 5.07-5.08 5.115—5.125 Thu Wed, New York 5.10-5.11 5.20—5.11 Source: Rothschild18 words
-
Article89 1996-06-15 43 Physical (Ss) Fri Thu KHobar *****-*****.22 *****-*****.18 100 gm 1740-1823.10 1744-1827.22 50 gm 872-916.70 874-918.76 20 gm 347-372.86 348-373.89 sgm 87-100.94 87-101.97 ftH 1 gm 17-27.81 17-27.81 Bullion coins (Ss/oz) S'pore bullion coin 560—566 561—567 Canadian maple leaf 560—566 561—567 Australian nugget 556-580.92 558-582.98 ÜBS gold Kln«bar™(Ss/o*) 554-592.2589 words
-
Article302 1996-06-15 43 BUSINESS LOANS Local Enterprise Finance Scheme (LEFS) and Local Enterprise Finance Overseas Scheme (LEFSO) loans are available from 30 banks and finance houses. Export Factoring 1 year 3v>' Domestic Factoring 1 year 6 "4 Equipment and Factory loans up to 4 years 6 v* Equipment and Factory loans302 words
-
Article66 1996-06-15 43 CRUDE PRODUCT PRICES CRUDE/PRODUCT MONTH* CHANGE PRICE (US$) BBL BRENT BLEND Jul +0.05 0.05 17.93— 17.98 WEST TEXAS Irrterm Jul +0.10-0.10 19.94- 19.98 DUBAI FATEH Jul -0.10 0.10 17.30— 17.40 TAPIS BLEND Jul +0.30-0.30 20.45- 20.55 MWAS Jul +0.20-0.20 19.60- 19.70 NAPHTHA {CIF Jap) 0.00 183 50-185^0 NAPHTHA 0.00 18.90—66 words
-
SIMEX FUTURES
-
Article30 1996-06-15 43 Opm Mgh Low SMt EttVol Aug96 17.57 17.57 17.55 17.55 98 S« 17.24 0 Od 17.04 0 Nsv 16.88 0 Act Voi (Thu): 33. Open W Oh* 2346.30 words
-
Article69 1996-06-15 43 Euroyen 3-month deposit (100 rnpfed interest rate) High Low Sett EstVol Jun96 9*42 9954 99.42 99.43 1810 Sep 99.17 99.19 99.16 99.18 3610 Deb 98.82 98.85 98.81 98.85 8285 Mar 97 98.51 98.55 98.49 98.55 5655 Jun 98.19 98.25 98.19 98.25 820 Sep 97.92 97.97 97.92 97.97 1156 Dec 97.6769 words
-
Article21 1996-06-15 43 r Opm High low Sett EatVol Sep96 108.69 108.74 107.96 108.08 427 Act Vo)PhuU7s. Open W (ThuHBl.21 words
-
Article27 1996-06-15 43 Open High Low Sett EtfVol Sep96 1I&72 118.82 118.60 118.82 287 Dee 117.63 117.85 0 Act Vol (Thu): 184. Open Irt (Thu): 2293.27 words
-
Article36 1996-06-15 43 Open High Low Sett EstVol Spot 313!61 317.36 313.61 315.71 3n% 315.4 318.48 315.4 316.5 2 Sep 316.9 0 Sc 316.9 0 Ma? 97 317.1 0 Jun 318.5 0 ActVoKThu): 728. Open htfFhu): *****.36 words
-
Article72 1996-06-15 43 Eurodollar 3-month deposit (100 rr&ed interest rate) Open rtgh Low Sett ErtVol Jun96 9441 9«1 94-40 94.40 2000 Jd 94.31 94.31 94.31 94.30 347 Auc 94.19 94.19 0 Seo 94.10 94.11 94.09 94.09 9850 nS 9373 93.76 93.72 93.73 ***** Mw97 93!53 93.58 9352 93.53 ***** jS 9334 93.37 93.3472 words
-
Article23 1996-06-15 43 Open High Low Sjtt EtfVOI fim% 385.40 o§™ 388.20 Dec 391.10 Feb 97 393.90 aJT 396.50 Act Vol (Thu): NH. Open lnt(Thu):NK.23 words
-
Article38 1996-06-15 43 Open High low sen t«v« SPOT *****.31 *****.91 *****.31 *****.39 a* i 2095 m i 2OOO sa *****s 4692 597S 97 z z iiliß jS; ***** 0 let Vtt (Thu): *****. Open tt fThu): *****9.38 words
-
Article25 1996-06-15 43 Euromark 3-month deposit ill B»i Z 96.27 |^97 95.93 Jun 90.50 Sep 95.19 Dec 94.86 Mar9B 94.87 Act Vd (Thu): Ml. Open W (Thu): Ml.25 words
-
Article22 1996-06-15 43 Open High low sen t«vw Spot 7334.74 7391.59 7325.94 7354.31 Jun96 Act Vol mw): Nl. (Thuh Ni.22 words
-
Article32 1996-06-15 43 r Open High Low Sett EttVol Sep96 1.5273 1.5274 1.5213 1.5222 172 Act Vol (Thu): 100. Open kit (Thu): 87. Spot Index on market doted. Settlement Price not available.32 words
-
-
-
MONEY 5
-
Article54 1996-06-15 44 June 14 Change ST Industrials 2270.93 -6.02 ST Finance 4919.47 inch ST Hotels 2119.30 +0.76 ST Properties 2058.07 +9.33 BT Composite 2179.58 -3.90 BT-MGA 1115.71 -3.57 BTO6/0S -244 +6 BTCADI -***** +37 BTOBV +*****745 +***** DBS CPF Index 655.55 —1.30 OCBC 1629.35 —2.65 UOBOTC 1159.82 +2.23 UOBSesdaq 92.75 +0.4054 words
-
Article4084 1996-06-15 44 19M/M Curr LMt Vd Day Or 1 Nat MCapWtAvg High Low Company Traded Bato +or- '000 High Low Div% r/E $mll Prlco 214 168 Ao^Boc t0M ul 193 CO +7 201 193 187 5.0N 11.9 319.5 494 390 mt MmaßOe 40Bed unch 21 410 409 27.0 12.3 074*4,084 words
-
Article64 1996-06-15 44 MAIN CLOB Up Dn linen Up DnUnch Industrial ..53 34 36 24 10 9 Finance 10 7 6 4 3 1 Hotels 5 4 2 2 0 1 Properties ..9 2 3 8 6 4 Plantations. o 0 0 4 3 1 Mining 0 0 0 4 0 064 words
-
Article30 1996-06-15 44 HK Land US$O.lO. 10,553,000 JSH US$O.O5 50c. 10,408,000 Amcol2sc 7,201,000 RFJMWt96 3,980,000 UIC 2,777,000 JMH US$O.25 40c... 2,700,000 UniphoenixTSß 2,561,000 SingTel 15c 2,095,000 DairyF US$O.O5 1,529,000 RenongWtOO 1,484,00030 words
-
345 1996-06-15 44 CHAN WEE CHUAN - CHAN WEE CHUAN MARKET REPORT SINGAPORE shares were broadly higher for the first time this week led by situational interest in several foreigncurrency denominated stocks However, the Straits Times Industrial Index finished lower, dented by selling in two component stocks in the last345 words
-
Article60 1996-06-15 44 Total Market Thu Fri Industrials 40.897 m 30.338 m Finance 7.480m 7.154 m Hotels 0.658 m 0.676 m Properties 6.149 m 8.768 m Loans Stocks 5.228m 9.017 m Plantations 238,000 432,000 Mining 1.223,600 767,000 Total volume 61.874 m 57.153 m Total value in Ss.. 223.699 m 197.747 m60 words
-
Article37 1996-06-15 44 HIGH LOW Straits Times Industrials 1996 High ....2493.71 (6/2/96) 1995 Low.. 1916.94(23/1/95) All-time High 2493.71 (6/2/96) All-time L0w 64.83 (29/6/65) Business Times Composite 1996 High ....2321.12(2/5/96) 1995 Low.. 1799.33(24/1/95) All-time High ..2398.87 (5/1/94) All-time L0w 64.83 (29/6/65)37 words
-
Article1819 1996-06-15 44 AaihwmquoMhmaparnliMorsliMlMO(lMr«lMi|MC««l.* Weighted amage piteafor AVJannlngs to*j| bi trading in this clock it restricted to buying-in market only. Abutted for scrip/rights. N Tax^emptad dividend. P/E ratios reflect the last annual consofdated results. P/E ratios and Gr"sYTd of fore^ sham are adyg for currency dHTerenca*. t Trurtee stocks under CPf1,819 words
-
Article638 1996-06-15 44 1906 Curr Last Vol Day Qft Nat MClpiAg High Low Company Traded Sato -t- or- '000 High Low Wv% P/E tmN ma 289 228 aABRHIdgsSc 230 cd uncil 40 231 230 3.0 143.8 102.3 232 234 138 e AstamatrTx SOc 138 -4 82 142 138 34.8 -JJI? 97 74.5638 words
-
Page 44 Advertisements
-
MONEY 4
-
Article, Illustration510 1996-06-15 45 Sumitomo trading scandal Ufa intention 9 to sell outstanding contracts or pull out of trade arena, says president fSfcfO Sumitomo Corp president Tomiichi Akiyama yesterday the company IH» no intention" of selling Outstanding contracts or with- drawing from the international capper market after sufferingAFP; Reuter - 510 words
-
553 1996-06-15 45 LQNDON A loss by Japan's Sumitomo Corp of US$l.B bil- |ion (552,5 billion) in unauthorMifca copper trades and its dismissal of top trader Yasuo Hamanaka is the latest in a "Clutch of scandals to hit the r/Ejffhdon Metal ExchangeReuter - 553 words
-
233 1996-06-15 45 TOKYO Sumitomo Corp's US$l.B billion (S$2.S billion) loss on copper trading throws the spotlight on one of Japan's oldest ana most unique corporate institutions: the general trading company. Starting life in pre-war Japan as commodity import and export businesses, the trading companiesNYT - 233 words
-
640 1996-06-15 45 TOKYO Every work day "Mr Copper" leaves his modest house in the posh Tokyo suburb of Chiyogaoka for the downtown offices of Sumitomo Corp, where he is transformed from a nondescript salaryman to the most powerful trader in the world's US$27 billion (Ss3B billion)Bloomberg; Reuter - 640 words
-
-
Page 45 Advertisements
-
Advertisement393 1996-06-15 45 f£j3H9!S"tt3Bl ■■■■■■■■■iirini I UNRIVALLED m Iv n Pi^JH IPH HI mew U EilEJlil II I ar^k w% gk m JT^ Wk ll I flßp IPRPRH E jflHtS 1 m I I^W Strategically located in one of Kuala Lumpur's financial, agggtj^ -««^^3 1 II W^ commercial, shopping districts to draw shoppers393 words
-
-
MONEY 3
-
Article, Illustration381 1996-06-15 46 Colin Tan - Colin Tan By EXPANSION by manufacturing companies continued to boost demand for Jurong Town Corporation's (JTC) factories and industrial land during the first quarter of this year. Singapore companies made up an average 62.3 per cent of all industrial space allocated during381 words
-
173 1996-06-15 46 MOMBASA (Kenya) —The Port of Singapore Authority (PSA) and Hongkong-based Portia Port Management Company are leading bidders to manage a container terminal at the port of Mombasa, senior Kenyan officials said yesterday. An announcement on the winner of the tender wasReuter - 173 words
-
223 1996-06-15 46 TOTAL outstanding bank loans for the month of April rose 17.4 per cent This was slightly higher than the 17.2 per cent of the previous month, according to figures released by the Monetary Authority of Singapore yesterday. Loans granted to non-bank financial institutions increased to223 words
-
230 1996-06-15 46 DAIWA Bank Ltd said yesterday it would be closing its futures dealing unit in Singapore. A senior official from the Japanese bank's Singapore branch said the closure of the futures dealing unit, Daiwa B.K. Financial Futures Singapore Pte Ltd (DBKF), would affect neither the230 words
-
Article245 1996-06-15 46 BANK of China (800 will be setting up a merchant banking arm in London, and it will set up a subsidiary eventually in Singapore. "While we cannot say how long this will take, we are basically moving along that direction," said the assistant general manager245 words
-
MONEY WORLD
-
Article122 1996-06-15 46 MANILA The Philippine Stock Exchange has ,-< exempted infrastructure projects from the three-year track record rule required for companies planning initial public offerings (IPO) The rule requires applicants to have cumulative >> consolidated pre-tax profit of 50 million pesos (Ss2.B million) or more for at leastAFX-Asia - 122 words
-
Article88 1996-06-15 46 TOKYO Japan's Economic Planning Agency left its monthlv assessment of the economy unchanged git; yesterday but voiced concern over a slowdown in f nw semiconductor production and the employment situation. goi; Toshiba Corp said on Tuesday it had lowered its l3f. output target for 16-megabit dynamicAFP - 88 words
-
Article57 1996-06-15 46 HONGKONG Dragon Airlines (Dragonair) is to start flying to Taiwan next month, and has appointed new directors to its board, an airline spokesman said jgfc yesterday. The inaugural service to the southern city of Kaohsiung will take place on July 31, she said, subject toAFP - 57 words
-
Article50 1996-06-15 46 HONGKONG Sun Hung Kai Co (SHK), once Hongkong's biggest Chinese-owned brokerage, said several companies are interested in buying part of its financial services business. "The company has been ro approached by independent third parties, said company secretary Hester Wone. She declined to name the interested parties. BloombergBloomberg - 50 words
-
-
-
Page 46 Advertisements
-
Advertisement858 1996-06-15 46 r CXFIC 5 VJ asia pacific breweries limited (Incorporated in the Republic of Singapore) RESULTS FOR THE HALF YEAR ENDED 31 MARCH 1996 The directors are pleased to announce the unaudited results for the half year ended 31 March 1996:- 1998 1995 Change 1998 1995 Change SSM S$M S$M S$M858 words
-
Advertisement67 1996-06-15 46 I 4I Brisbane Gold Coast Melbourne Perth Sydney The Widest Range Of Top Value Property Investments Sole marketing agent and \yf r|f»f*||^f-f- f-ff|f~pl permanent showroom: JViarriUl.l flUtCl HSR international Realtors Re Ltd Belimbing Room The Leadin 9 A 9ency since mo Sat, 15th June Sun, 16th June -«^j- jo^son Road,67 words
-
-
MONEY 2
-
403 1996-06-15 47 Tammy Tan - Tammy Tan ;By Move aims to develop firm's potential SINGAPORE Telecom may {sell part, or all, of its whollyowned cable television investment in Sweden, STjarn TV, so that the tatter's potential could 'be "developed fully". Responding to queries from403 words
-
Article, Illustration428 1996-06-15 47 iFRASER Neave's listed property arm, Centrepoint Properties Ltd (CPL), saw a 64M> per cent jump in net earnings to $62.5 million for the six months ended March 31. The better performance was mainly a result of higher development profit from The Anchorage condominium428 words
-
Article, Illustration412 1996-06-15 47 Freddie Ng - Freddie Ng fir MAINBOARD-LISTED Roly [njfernational Holdings Ltd said yesterday that the United Stajtes Securities and Exchange Commission (SEC) had Sallowed its US dollar-denomi-nated shares here to be traded pn the Over-The-Counter <OTC) market in the US. The scheme,412 words
-
547 1996-06-15 47 Jean Chia - Jean Chia By The five Jardine counters chalked up a combined volume of 26.8 million shares, accounting for more than a quarter of the 96.8 million units traded on the local bourse yesterday. JARDINE Matheson Holdings (JMH) was on a buying547 words
-
174 1996-06-15 47 The Stock Exchange of Singapore (SES) will add three new indices on July 1 to better position itself as a regional bourse. Television Corporation of Singapore (TCS) reported yesterday that the new benchmarks will be the Electronics Index, the Foreign Index and the174 words
-
397 1996-06-15 47 CEREBOS Pacific Ltd has turned in a record $47.2 million net profit for the half year ended March 31, up 15 per cent over the same period last year, lifted by a continued good performance by the group's flagship line, Brand's Essence397 words
-
COMPANIES IN BRIEF
-
Article65 1996-06-15 47 ACMA Ltd has been granted in principle approval by the SES for its bond cum warrants issue, which it had announced on May 29. The issue comprises $100 million worth of 2.45 per cent unsecured bonds due 2001, with 41.4 million detachable warrants. The warrants65 words
-
Article48 1996-06-15 47 AMCOL has completed the subscription of a further 3.3 million new shares in Guibes Holdings for a purchase price of U5525.98 million (5536.51 million). With the purchase, Amcol now holds a total of 5 million Guibes shares, representing a 40 per cent stake.48 words
-
Article51 1996-06-15 47 THAILAND'S Thai Danu Bank Public Company has signed a loan for US$BO million (S$ 1 12.4 million) from Singapore's offshore loan syndication market DBS Bank was the co-ordinating arranger and agent for the loan. It joined another nine international banks as lenders i in the51 words
-
Article57 1996-06-15 47 Freight Links' new HK unit FREIGHT Links Express Hold' ings (FLEH) has taken a 51 per cent stake in dormant company Freights Links Express (HK) (FLEHK),forHKS77S,OOI (*****,580). In addition, FLEH subsidiary Vincent In tertrans Holdings has also taken up a 19 per cent interest in FLEHK FLEH intends to use57 words
-
-
-
Page 47 Advertisements
-
Advertisement114 1996-06-15 47 PRESUMING THE TO BEST D^llllfr OPTOSTUMffi m IN PERTH PROPERTIES JOONDALUP ,i Run til Aracnt i i I Z&&&/ Managing Director j*3v"^^ I' W«ißm!D«elopiient(J)M*lld j A |fc-«r**^\| x H Builder RcgHtration Mo. 91» CurtinAntf^vA Mtwttr Of Housing Industry Association Edith Cowan JKKf in, University ll^v^ im w "Ci^_i^^^^lmlH I A114 words
-
-
The Straits Times Money
-
Article54 1996-06-15 48 TOP RISES Cents 4- JMH US$O.25 40c... 715 50 7.5 RothmansM 50c.... 1450 40 2.8 JSH US$O.O5 50c.... 316 32 11.3 DBS Foreign 1740 20 12 Spore Land 975 20 2.1 DBS 950 15 1.6 Pub Bk Foreign 360 12 3.4 STE&E Foreign 144 11 8.3 C&C 1440 10 0.754 words
-
Article48 1996-06-15 48 TOP RISES Cants MMCR6OO 17 41.7 5 RFJMW96 .....5.5 22.2 1 MMCR 15 20.0 2.5 JSHWt9B 32 16.4 4.5 CMSRmbI 342.5 16.1 47.5 BerjayaLßd97 65 12.1 7 JSH US$O.O5 50c.... 316 11.3 32 STE&E Foreign 144 8.3 11 JMH US$O.25 40c... 715 7.5 50 MBfHIdgsTSR 20.5 5.1 148 words
-
Article45 1996-06-15 48 TOP FALLS Cents F&NWt9B 775 40 4.9 FAN 1520 30 1.9 SlAForeign 1410 30 2.1 SPHForeign 2610 30 1.1 RashidHussain 490 25 4.9 Cerebos2sc 1210 20 1.6 San Teh 20c 110 20 15.4 OUT 358 12 3.2 UniphoneTel 207 11 5.0 TACBUO2OO 895 10 1.145 words
-
Article43 1996-06-15 48 TOP FALLS Cents SanTeh2oc 110 15.4 2$ ChinaNUSSO.OI 60 7.7 5 AVJenningsH 55 5.2 3 BZWSIAFVW9/ 28.5 5.0 1.5 UmphoneTe) 207 5.0 11 F&NW9B 775 4.9 40 RastodHussain 490 4.9 25 ICTHKS 60 4.8 3 TIBSWtOO 100 3.8 4 UEWt9B 115 3.4 443 words
-
Article, Illustration599 1996-06-15 48 Suki Lor - Suki Lor By SOFT drinks giant Fraser Neave announced yesterday its group net earnings had jumped 31.7 per cent to $101.9 million for the six months ended March 31, 1996. Earnings per share rose to 35.2 cents, from 27.2 cents previously. Analysts599 words
-
266 1996-06-15 48 Foreign reserves surpass $100b for first time SINGAPORE'S foreign reserves have crossed the $100 billion mark for the first time. New Monetary Authority of Singapore figures show the official reserves amounted to $100.61 billion at the end of April, which was an all-time At Ssloo billion, Singapore's foreign reserves equal266 words
-
Article, Illustration524 1996-06-15 48 Sim Wai Chew - Sim Wai Chew Sumitomo trading scandal By A PLUNGE in copper prices is unlikely to have a significant impact on industries in Singapore, companies said. Copper prices had tumbled on world markets yesterday on news of giant Japanese trading house SumitomoTimesgraphics - 524 words
-
-
Page 48 Advertisements
-
Advertisement135 1996-06-15 48 J EL. fsStimOUßH'Kv 9 /ill /S) >s\ ti^M, iii 'Sr^^ss HSJ/^hk iBi iM^xywll^^ HHmb *s» 100% Natural garble Coffee Table fit Ml/ 1 (<ul ®W i Single doc hi ""-^t' J «MMfIHk > OO y)enifi <\)udio OO fflbme tfunushiny &a//ery f W269, Pasir Panjang Road, Singapore 11 8629 195 Lavender135 words
-
Advertisement270 1996-06-15 48 More reports: Page 45 r^fc lIOLIPAYS PAGER BONANZA f >. AT KNOCKOUT OFFERS/ J ff\ /0 15-30 June '96.^2""^>v too^ y j j mi FPFF I"™ m I I^*V (wi Vworth up to $45 I f U MOTOROLA BRAVO ~^H \J I "I J EXPRESS RP4I if) b I; P270 words
-
-
THE STRAITS TIMES Life!
-
Cover Story
-
Article, Illustration932 1996-06-15 2 THE 2 Cs THAT SPELL LUXURY THE Chanel brand is 13 years old in Singapore. It used to cater to mainly Japanese tourists until 1991, when Karl Lagerfeld created a Chanel collection in motorbiker's fashion with leather pants, chain belts and boots. That was the year,932 words
-
-
Life at Large
-
Article, Illustration1054 1996-06-15 3 So, you want to see the executive condo showflat? Life! gives you a sneak preview on pages 20 21 and on this page, an assessment by property consultants. Stephanie Yeo reports. The attached bathroom with a long bath is as good1,054 words
-
Article, Illustration274 1996-06-15 6 RAVI VELOO - But they have kicked the habit RAVI VELOO SOME people take what they read too seriously. A tongue-in-cheek advertisement in The New Paper on Monday called for three "reformed FA artists" for a "hardcore creative agency" and a few ex-drug addicts called up. Maybe they just did not look beyond274 words
-
Article, Illustration767 1996-06-15 6 LEONG WENG KAM - LEONG WENG KAM IT IS three months after the mad-cow disease scare first erupted in Britain, but some Singaporeans are still giving steaks and beef noodles a miss. Sales at steak houses and beef noodle stalls in town and the Housing Board estates haveCHEW SENG KIM - 767 words
-
Article, Illustration826 1996-06-15 8 Chua Mul Hoong - Chua Mul Hoong Heartlanders AS THE television advertisement jingle goes, Uncle Yong has never been the same since he returned from a two-week holiday in Australia. He fell in love with the vast open spaces, the big bungalows which cost a fraction826 words
-
Article, Illustration628 1996-06-15 10 Experts say a main concern is the amount of fresh air circulated in the cabin AIR travel can seriously damage your health. Illnesses ranging from pneumonia to heart attacks, and even cancers, are occurring within days of flying, says a new study. As manyThe London Sunday Telegraph - 628 words
-
666 1996-06-15 10 ELISABETH GWEE - ELISABETH GWEE AEROPLANE passengers breathe in air filtered through the same type of filters used in critical-care wards of hospitals, said a specialist in aviation medicine in Singapore. Dr Lim Meng Kin, who is also the director of the Defence Medical Research Institute666 words
-
Article, Illustration554 1996-06-15 11 On the rise: Romances among Japan's old JAPANESE people are gradually realising that Frank Sinatra's old song, Love Isn't Just For The Young, is not just for Americans. The traditional notion that romance among older people is taboo is being challenged in Japan. And the 1 reasons are obvious: Ja-NYT - 554 words
-
305 1996-06-15 11 THE nervous young Frenchman sidles up to the cute American girl. "You're roller-blading like a goddess," he mumt., bles. "Do you have a boy- friend?" "What a trite compli- ment. Everybody here i* knows how to roller-blade," comes the terseAFP - 305 words
-
-
Leisure
-
Article, Illustration552 1996-06-15 12 CHIN SOO FANG - Man in the middle again CHIN SOO FANG SHORTTAKES OH NO, it is happening again! After his scandalous act of bigamy in the serial Golden Pillow, Hongkong star Alex Man (above, centre) will be romancing three TV actresses in a new TCS production called Xing Ah Lang Gu Shi (The552 words
-
264 1996-06-15 13 ANG E ERN - ANG E ERN NpRTH, south, east, west Seng Fest '96 is making its presence felt across the isfan<J by going on the road. The newly-introduced Road Shows, which kick off tonight, will bring semiiinalists from the karaoke aKgroup singing competitiSs264 words
-
Article, Illustration256 1996-06-15 13 Thomas Lay; Lay Sock Mum - Songs bind singing siblings Thomas Lay Lay Sock Mum and EVER since Thomas Lay, 17, and Lay Sock Mun, 20, started singing with the Soka Youth Chorus about four years ago, they have been growing closer as a family. According to Thomas, he became interested in singing when he wasLIM SENG TIONG - 256 words
-
Article, Illustration246 1996-06-15 13 Marc Jonathan; Stewart Lee - Marc Jonathan Stewart Lee and SINGING as a family is fun, says Major Richard Lee, 37, a Singapore Armed Forces officer. He should know. His sons, Marc Jonathan and Stewart, enjoy singing together so much they joined the Saint Andrew's Junior School choir to participate246 words
-
Article, Illustration421 1996-06-15 13 Victor; Nicholas Tan - Victor Nicholas Tan and composers of Keep The Faith: PUT a chemist, an air traffic controller and an importexport trader together and what results? Beautiful music, according to the Tan brothers, who come together about thrice a month to compose songs. Despite their421 words
-
Article, Illustration183 1996-06-15 14 Rebecca Lim - Rebecca Lim Music Notes RENOWNED Japanese pianist Izumi Tateno is back for his third performance in Singapore today. He was here in March last year to give the first performance in the then newlycompleted 600-seat Suntec City auditorium. For his piano recital this time183 words
-
FESTIVAL OF ARTS'96
-
Article, Illustration379 1996-06-15 14 S.Y. Whang - S.Y. Whang John McLaughlin's reputation as global music explorer obscured by format MUSIC JOHN MCLAUGHLIN "THE FREE SPIRITS" Raffles Ballroom Thursday THE first of two jazz events in this year's Arts Festival featured John McLaughlin's Free Spirits. The group comprised McLaughlin on guitar, Joey379 words
-
Article, Illustration398 1996-06-15 14 ANG E ERN - ANG E ERN FRINGE FESTIVAL '96 MUSIC YALE GLEE CLUB: 1 35th Anniversary Season Victoria Concert Hall Thursday IF THURSDAY night's concert was anything to go by, Yale rules. Fresh from its appearances at the Great Wall of China and the Hong Kong398 words
-
-
Article, Illustration315 1996-06-15 15 Singapore-based KMP Group of Companies gives highest cash donation received by Heritage Board ONES million dollars gets you a spanking-new wing at the Singapore Art Museum. At least, that was what Singapore-based KMP Group of Companies received when it signed over $1 million to theSTEVEN LEE - 315 words
-
Festival Follies
-
Article98 1996-06-15 15 THE Urban Bush Women displayed their urbane mettle with a certain primitive savagery when they were in Singapore recently. During a press conference, the 12 members of the dance troupe were fidgetting and dying to get the entire affair over and done with. Their secret agenda?98 words
-
Article104 1996-06-15 15 THESE days, virtuoso guitarist John McLaughlin is not content with just working magic with his fingers over the fretboard. At a press conference at the Westin Stamford, he was seen holding several books on magic and card tricks. When asked about them, McLaughlin remained tight-lipped. One104 words
-
Article81 1996-06-15 15 MEMBERS of Ave Sol, the critically-acclaimed choir from Latvia, were having a late-night supper at the Cricket Club after one of their performances when they treated the other patrons there to a beautifully-harmonised song. Full of beer and food, the smiling choir members sang at81 words
-
Article116 1996-06-15 15 NEVER finding for time for the Festival Of Arts? Fret no more. The Festival Club (aka The Stamford Cafe at the Westin Stamford) is organising a jigsaw puzzle challenge on its premises. The first two participants to fix the giant jigsaw, sporting the festival motif,116 words
-
-
Article, Illustration693 1996-06-15 16 PAUL ZACH - PAUL ZACH Less-than-enthusiastic reviews over his debut album, but the 25-year-oM seems unconcerned IT IS not easy being a rock star who has just signed a contract with a major record label rumoured to be around U*****,000 (*****,000) on the basis of a single album.693 words
-
Article, Illustration542 1996-06-15 16 REBECCA LIM - REBECCA LIM It is nice to have records which sell. But if we were so caught up with sales, it would have been a very hard business to survive in.' Michael Timmins MICHAEL TIMMINS is a poet and a musician. His name may not542 words
-
Article, Illustration907 1996-06-15 19 ONG SOR FERN - ONG SOR FERN On its first album in almost five years, the Bay Area quartet leaves behind its signature chord progressions and double- and triple-time machine-gun thunder Sound Bites LOAD MetalHca (Dektra) **l/2 JAMES HETFIELD sings more than a few ballads.907 words
-
-
Interiors/Exteriors
-
Article, Illustration314 1996-06-15 20 STEPHANIE YEO - Just like a private condominium STEPHANIE YEO Text: WHAT is the difference between an executive condominium and a private one? In terms of finishings, hardly anything. The compressed marble floor in Jurong East's Westmere living-bum-dining room can also be found in freehold Estella Gardens in Changi, launched recently. Some privateLIM SIN THAI - 314 words
-
Article, Illustration194 1996-06-15 20 Total number of units: I about 2,100 Eastvalo Developer: Pidemco Land Units: 312, from 1,076-1,399 sq ft Facilities: Clubhouse, swimming pool, tennis court, playground, basement parking and security Price: $428-$465 psf Launch date: End-June 1996 Completion date: 1999 Westmere Developer: Pidemco Land Units: 280, from 1,076-1,399 sq194 words
-
Article, Illustration154 1996-06-15 21 ABOVE: Step in from the solid timber door at the main entrance onto the cool compressed marble of the living-cuni'dining room. It comes with skirting at the bottom of the walls, cornices and an audio intercom. The en-suite bathroom is luxurious, with a long bath,154 words
-
-
Books
-
Article, Illustration1179 1996-06-15 22 Yeo Lay Hwee; Leo Suryadinata; Asad Latif - Yeo Lay Hwee Leo Suryadinata Asad Latif Two new publications highlight Singapore's public policy achievements over the past year and the challenges ahead Current Affairs SINGAPORE: THE YEAR IN REVIEW 1995 Edited by The Institute of Policy Studies/ Times Academic Press, 92 pages, $9.901,179 words
-
644 1996-06-15 22 A SELF-DESCRIBED "clod" who says he often wakes up at 4.20 am hearing the voice of God is now a hotselling author with speaking engagements booked through August next year. Neale Donald Walsch, 52, author of Conversations With God,Reuter - 644 words
-
NEW ARRIVALS
-
Article, Illustration129 1996-06-15 23 LOSTLAYSEN by Margaret Mitchell Orion/127 pages/524.95 ANOTHER one of those long-lost novellas unearthed with maximum media hype. This one is by the author best known for the classic story, Gone With The Wind. And it is surprisingly good. Lost Laysen129 words
-
87 1996-06-15 23 SLOWNESS by Milan Kundera, translated by Linda Asher Faber Faber/132 page**33.94 MILAN KUNDERA'S first novel in five years is also his first attempt at writing in French. Linda Asher's translation captures Kundera's pellucid writing, which seems eminently suited for the precision of the French87 words
-
Article97 1996-06-15 23 THE top five international and local paperbacks sold at Times bookshops over a seven-day period, ending Tuesday. L Morning, Noon And Night by Sidney Sheldon 2. Op Centre 3: Games Of State by Tom Clancy 3. A Place Called Freedom by Ken Follet 4. Seinlanguage by Jerry Seinfeld 5.97 words
-
107 1996-06-15 23 IRONING JOHN: THE HOUSE HUSBAND'S TALE by James Lefth The Atlantic Monthly Prats/ 234MfM*29.18 THIS hilarious memoir details James Leith's experiences as a bumbling househusband. Attacking the chore with a "masculine, methodical and systematic" approach, Leith soon realises that a '"house-husband's work107 words
-
Article102 1996-06-15 23 COLLECTED STORIES by Tennessee Williams Minerva/574 pages/$19.30 A VALUE-FOR-MONEY package for the Williams fan. This compilation contains published and unpublished stories. The most famous story here is The Night Of The Iguana, made into a movie starring Ava Gardner. Williams explores familiar territory in the102 words
-
Article81 1996-06-15 23 50 WAYS WITH POTATOES by Rosemary Wadey Crescent Books/112 pages/514.60 POTATOES may not be your first idea of healthy food but the spud is a much-maligned vegetable. The recipes here emphasise light and healthy dishes. They are written in a straightforward manner that will make81 words
-
111 1996-06-15 23 Critical look at 10 US presidents CHARACTER ABOVE ALL edited by Robert A. Wilson Simon 4 Schustef/ 256pages/$24.95 THE United States' presidential race is looming and this book has been issued to take advantage of the interest in the presidency. It brings together case studies of 10 presidents from Franklin111 words
-
-
Article, Illustration1077 1996-06-15 24 Noa Ben Artzi- Pelossof; Sunanda K. Datta- Ray - Noa Ben Artzi-Pelossof Sunanda K. Datta-Ray Granddaughter's deeply moving memoir off her beloved fallen hero has inevitable Zionist political thrust Biography IN THE NAME OF SORROW AND HOPE By Knopf/181 pages/$30.62 The Holocaust became a pillar of our national identity. What happened to1,077 words
-
Article, Illustration326 1996-06-15 24 MR NICHOLAS LEE, 31, actor/show-host who plays Ronnie Tan on homegrown television sitcom Under One Roof: I'M CURRENTLY doing some self-study in independent film production, so I've been reading quite a lot of material related to that. This includes Robert Rodriguez's Rebel Without A Crew, subtitled Or326 words
-
-
Motoring
-
Article, Illustration613 1996-06-15 26 Women flocked, men shot hungry glances, when Leow Ju-Len drove the Peugeot 306 CabHolet THIS is it: The face that launched a thousand hungry glances from passers-by. At the risk of feminine ire, which I believe to be minimal because most women I613 words
-
Mixed Grille
-
99 1996-06-15 26 BORNEO MOTORS, the distributor for Toyota and Lexus cars, has just opened a $3million car bodyshop. The Toyota Car Bodycare Centre is equipped with the latest state-of-the-art facilities run by well-trained professionals. With the new facility, Borneo Motoim is now able to provide its customers99 words
-
Article, Illustration88 1996-06-15 26 SPEAKING of cabriolets, BMWs M3 muscle car is now available as a convertible. Developed from the M3 Coupe, it shares a brutish 3.2-litre 321 bhp engine, which gives it outstanding performance. Its 0-100 kmh sprint takes a neck-snap-ping 5.6 seconds. Apart from exhilarating performance,88 words
-
166 1996-06-15 26 THE Ford Taurus is set to make its debut in Singapore very soon. The first mass-market American car to be sold in the Republic for decades, it will feature the acclaimed Ford 3-litre V6 Duratec engine. Hugely popular in the United States and166 words
-
-
-
The Back Page.
-
Article, Illustration446 1996-06-15 32 KELVIN TONG - KELVIN TONG FESTIVAL OF ARTS' 96 IT IS a monumental logistical nightmare for the National Arts Council. Numbering 130 singers, dancers and musicians, the Alexandrov Red Army Song and Dance Ensemble from Russia is a formidable singing and dancing machine that needsLILLIAN FOO - 446 words
-
-
Page 1 Advertisements
-
Advertisement414 1996-06-15 1 New Peugeot 306 Cabriolet Automotive birdseed that pulls the chicks 90 (Skip page if you're, n er, a feminist) U is? 9s 1116 z uS infli spoil luxury one thircl And these days> its the dau 9 nters of tai-tais who go for them. 0 A m re P° rts414 words
-
Advertisement140 1996-06-15 1 Two comprehensive commentaries of Singapore past and future 22 1 m i i ft I w, j J|": ill 3> For a short time, you can save up to 50% on B&B Italia furniture. Take your pick of our sofas, chairs, coffee tables, 1^ beds and wardrobes. But do hurry!140 words
-
-
Page 2 Advertisements
-
Advertisement426 1996-06-15 2 Oryimdl^g. 1 setting brand oj CMorelk inJapanWjjjSm AND NOW IT COMES WITH GIFTS FROM US y~*~^~|~^~^|; n 5=> W>: *^^|L^^ ____U__U_l' _l B_k tMPv___E2££Ss Bmv Sun c/i/ore//fl W A $195.70 F Cllft 0 ChiOf£HQ (mdusbecfCST) i I *y VI ______j_i_i P/ms GRAND LUCKY DRAW/ Prizes: 3 units Mobile Phone Consolation426 words
-
Advertisement43 1996-06-15 2 1 C^rreh L f JHl3! M'is®iliiPl J lllkM^ipilll^l m <^ Vv3iil6iS Br^bl Jk l^r^^ QO" $QH ruzt I B J Travelling Bags, Leather Shoes, Belts, L 1 Tie-clips, ete. 50% OFF/ F No. 1, Circular Road, Singapore *****7 J Tel *****85 Fax *****13 P43 words
-
Advertisement113 1996-06-15 2 Br I Professional fitting by qualified persons using computerised test equipment. Specialise in small custom made canal aids using high quality USA modules. Behind the ear, pocket, spectacle, programmable, remotecontrolled etc. Ear mould, battery, FM system, telephone amplifier, vibrating clock, Bionic ear etc. Business Hours Mon-Sat 9:3oam- s :3opm IlAr/f/tr*113 words
-
-
Page 3 Advertisements
-
Advertisement9 1996-06-15 3 Just like a private condominium: See Page 20 219 words
-
Advertisement22 1996-06-15 3 I I I H p^P^^^^^ n^^^^^^^^^ I Br BBk I BT JJ B& V I BT 1 11 I BH bbbßbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbhbmbmbbbbbbhbbbhhhhh*^*^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ bj^^22 words
-
-
Page 4 Advertisements
-
Advertisement44 1996-06-15 4 ON YOUR 60TH ANNIVERSARY OF THE SINGAPORE BRANCH HBBHB \3U^ BANK OF CHINA I The Goldtron Group Of Companies I I 1 00 Beach Road #1 9-00 Shaw Towers Singapore 1 *****. I Tel: 296 5000 Fax: 296 4332 Telex: RS ***** GTRON 144 words
-
-
Page 5 Advertisements
-
Advertisement250 1996-06-15 5 ON YOUR 60TH ANNIVERSARY OF THE SINGAPORE BRANCH BHBBHB leA m&s V3C^ BANK OF CHINA PRESIDENT MARINE I THAKRAL GROUP OF COMPANIES PRESIDENT MARINE (PTE) LTD I I Colombo Court #08- 1 7/25 Singapore 1 ***** m fy*z c& 4^=. /^c/ I \j^ rb =1 Tel: (65) 337 4292, 338250 words
-
-
Page 6 Advertisements
-
Advertisement312 1996-06-15 6 Swenserfs <£ Opens At i^j i^ 1 Tanglin Mall. |c K| Lb Y I I Xi a flfli L "'JtJI B Mmmw —^^aumm\ Kj:, jßk£~*%Mf'' I IP rap' "^^hLH BflP?% L ffi^k. B Za^B «£MMP l^ r ii3^^^^^ mW-~^ Sharon Aw James Lye II H^r B Meet your favorite stars312 words
-
Advertisement124 1996-06-15 6 BOM/IN* AHARI SW-650 SB-99 50W PASSIVE! 50W Active U.P. $138 j U.P. $238 Nows99^HHh Now $180 KEC® nuADJ sw- 600 I MnMnl U.P, $350 ggy SB -550 80W ACTIVE eo ■nIHH ups3s TMIM Now $260 Fid€k HRHJI FTS 802 120W ACTIVE U.P. $680 Now $480 JP^ Fidck® MHB FD-***** PROFESSIONAL124 words
-
-
Page 7 Advertisements
-
Advertisement220 1996-06-15 7 Congratulations W Best Wishes To V| I BANK OF CHINA J M SINGAPORE BRANCH M S on the occasion of fi jk 60 th Anniversary ll m /^v TAMARA GROUP P B >^ TAMARA BANK B JP PEK TEK BENG Wx M ATANG LATIEF W iy IWAN SUHARDIMAN Jl Jf220 words
-
Advertisement58 1996-06-15 7 VftllrtlllMlMi^ Uultimtdia CD-Rom Movie Trailers Music Clips Travel Scenes Shareware Internet Links Rock Climbing On Sato at: Amconics MPH Challenger Superstore Kinokuniya Book Store Stop Press Times the Bookshop Wright-Tech Multimedia Distributor http://webl atia 1 .com.sg/lifesty le/wiz For PCs only m f Didn't you know? I read it Citch Cats58 words
-
Advertisement429 1996-06-15 7 TOEI Company, Ltd. All rights reserved, ■pi I^^^. KirwAt^s- e 165 Power Rangers School Bags NOW For The Most Active Students! r 1 1 9f CL NOW AT 30-35% DISCOUNTS! $M jM WL KIAIAI m Y***** «2 I D U.P. $1 6 90 M Ll A A^ltf rtrf~jp^ NOW^. 1429 words
-
-
Page 8 Advertisements
-
Advertisement325 1996-06-15 8 I S Pl"' I 4f t II j± yi Li pi^/^. x %i w ciop Attpr n tnnnfh*s vniir h^nv '•^I/U,;,'' mR, Sis-pWr I nutrients to guarantee its rf rapid development I SL ill both physically and mentally Nutriton foltowK>n is a follow up formula for children over six months325 words
-
-
Page 9 Advertisements
-
Advertisement715 1996-06-15 9 SS SINGAPORE COATING pte ltd JEAN-LUC VERGNES Wl PHI PI H Pi M MANAGING DIRECTOR Fill jflVI It is with great honour v/e announce W J I^SS Xw A B H 111 Ifel our achievement of ISO 9002 m X^W M I 1 il Certification. This underlines our KSBL^l'^^l A,715 words
-
-
Page 10 Advertisements
-
Advertisement317 1996-06-15 10 nXXSofa Manufacturer's ii42 9 HB^^H 7"0% 5 J lpm to eptn^^^^^gMHKHMßßßßajl^^QS^y'^^ rf Jl i^^ 3+l+L FROM Fii/f Leathr* I 1 I Bk _^T BM^^M^ SjPMIH ~*9tet I J> c^ o ofIP^II wfa No:14 NEW INDUSTRIAL RD #05-01 ilj j m RICHWAY BUILDING ***** Utt| 4ft,«cTu# H0TL1NE:*****41 SS OF LEATHEH 80F«317 words
-
Advertisement13 1996-06-15 10 UsSorne Tuzzk fAdvtntwt Search For The Sunken City? Cost: 30 cents a minute13 words
-
-
Page 11 Advertisements
-
Advertisement306 1996-06-15 11 Hk*ft«»reWa*tei> "'^■fr Korea Karaoke Glass down Uqht with colour A m*9 J Music control Box w jA NMRNHHNHiiK^^^^^H yet ltd c <>H^'' «i 93 > Ju"'— '"ITltll.'l iiUmBI KSIfO $12 ■wwj^ Ik FLOOR UMPS pl96pcsi pffO |$12 1 Hr+ Tube M PL9 Tube 1 v f ■R+s3.So ■$12t$3 I PDFFERS23306 words
-
Advertisement488 1996-06-15 11 BIG REMOVAL SALE Everything Goes... 3 .DAYS ONLY 1 15, 1 [6 1 7 JUNE 96 '"^'^"'NEWARRiVAL Socr LAT ESf j^SPECJAr6>FEfi| qSSSVi!^ 5 1 Crtling Light GIaSS MilTOr Ceiling Ugh! ITALY ACRYLIC ADVCTAI 1 CHANDELIER l/HTMAL LATESf JAPANESE riMPO l 'lH M I I^UTC IR HHH W A L I488 words
-
-
Page 12 Advertisements
-
Advertisement126 1996-06-15 12 I H V^ V VJf 3 BaT Pfe "^m^wwiffl^wp^ ■t^^^b' JT a^at HbW ,avl Ib^ iaJk Jk w\ »'^F TSaWfi. ># I W"^ (Xirchase of any I it mfldr i ft V 3ROCKRECORDSCDs MM im^^ m mm mL£ FU^^g^T Jl IB i^^a^Ea^^ "a^P^L^B^ta^B^B^B^Baßii^^fl^^^V^^t fILB Symphonic Star Trei||« George MlcliaeT IWwpirationai126 words
-
Advertisement224 1996-06-15 12 HhHhMHMMI MHhHHNHHBNm i^4 At mgm Berjaya Georgetown Hotel, l^^flß a whole world of n excitement awaits you y&lffl/ from only RMl3B++ Centrally located, the new 330-room Berjaya Georgetown Hotel offers you a fascinating array of Penang's best for just a small price. RMl3B.oo++ for Superior Rooms and 40% off published224 words
-
-
Page 13 Advertisements
-
Advertisement733 1996-06-15 13 KkS^fln B^^^ £*S3/K*L' ~2^ai Achieve immediate guaranteed jHr returns of RM 69,984 with THE INVESTMENT PLUS PLAN. d RM rm Purchase a luxurious Seri Mutiara ir^tnu—, (Average apartment in Johor and receive (SF*l 1 1* Tt Purchase Price 233,280 GUARANTEED RETURNS of 30% of your Guaranteed Returns ***** property price733 words
-
-
Page 14 Advertisements
-
Advertisement199 1996-06-15 14 M OUT TO EAT. I Ihis Father's Day, why (ESBSSSf not introduce Papa to a yT^^mH^m Bh^^^§ B^^J /> for you, Htl because it's all for sale. J little country living. j/j^OjS^ Bring him to the \m^ WSk D^T J ust butter 9i^ him up a hot muffin first 8199 words
-
-
Page 15 Advertisements
-
Advertisement570 1996-06-15 15 I rSOW J*icc!% u y feoleh, mummy! W I fat me cuddly tOtjf $>Ob faed" I From 3tst of May onwards, ovory purchase of a jumbo pack of Soalor Disposable Diapers will entitle you to a free stuffed toy*. The cuddly toys include the cute panda bear, the gentle bunny,570 words
-
-
Page 16 Advertisements
-
Advertisement509 1996-06-15 16 __fl IP Ua mm 9 P=st l_n___l Hi HI H_ _*\f_ ni *s>M__i HI ___k Y\_.»>* _*ai_-^''' __ffi "M H^- :^__iPP"^_l _L^ Mir'*™ jm^^^HWl _9_ __N_B IB_r _^r 2 9?<^Lmm _h__ I £k j(#S* P A' v v 1 __r_Hr___^__ |p W& WMmmmmf^fmm\^lmmmmW fe" H___F_Hl m ___l\__l I _________B _^^^^V509 words
-
-
Page 17 Advertisements
-
Advertisement450 1996-06-15 17 TIMEOUT SR 101 ,/v*" J JW Swivel Rocker mKM R\ RI99F V.PMVi &M ZSWSiA Now $320 Hf "*^p W^^HPlfffifn^V^ Hr ANCORA(WO32) 2 Armchairs, 1 Sofa, 1 Centre Table, 1 Side Table^ggJ H LOMBOK Lounge (#021) UP '^roA Bm-P 2 Armchairs, I Loveseat, NOWs2^2»o KLT' m 1 Centre Table, I Side450 words
-
Advertisement80 1996-06-15 17 It m^^l i^^» m m m «l fluant Garde Slim Standing Lamp Y A A 9^l^^ Italian 3-D Polymat eric* Pictures I |i L Country LUootf Cabinet rocu douucijt rrutus: ttllßtiflaH W^!t aJ^^^rliMß^. .^k» Ik Bf Ba £i B^» i^B»^^^^^^^^^^^^^^ Ba^S^Bl\ ■^9^ > wli^BP^'_^L* i«js_ I "I make it a80 words
-
Advertisement246 1996-06-15 17 complete with energy saving white s+l Glosi Mirrors HL jM blue, green q^L Jh *^^^^fl E^ff^^ I^^^^^W I ffi fl "aIrfToW 48" 4 Bladed Ceiling Fan j Get free tabieiampw*! *B^ IVE N E T T (Australia) WRjT^T a^TlTefh^^ J <«>■/) l^ftol V^^^y' ~—J| (UK) Apprevwl by PUB >^ IsiSlßTtsttd246 words
-
-
Page 18 Advertisements
-
Advertisement845 1996-06-15 18 1 in m<^VsSSKKK9 Bk ill 11 g|y 0« 1 1 11 y aSi W^* m C%^Cl^« BB ftl'l B ':Mb ■7 \mltea => lu /~ustorn®U t^ kH m _j I 1 6-Button Joypad Controller •1 AC Adaptor (220V) •1 RF Cable c6O •1 AC Adaptor (220V) •1 AV Cable m845 words
-
Advertisement228 1996-06-15 18 I WARNING 1 NOTICE The public and trade are advised that Mr. Martin Van Der Hoeven is the owner of copyright and distinctive get-up of yfc yfc the ABFLEX as advertised on television and Abflex U.S.A. yfc ofa is the worldwide exclusive licensee of the intellectual yfc yfc proprietary rights228 words
-
-
Page 19 Advertisements
-
Advertisement22 1996-06-15 19 Guy Laroche PARIS END OF SEASON SALE 15 2 3 JUNE 30% T0 70% OFF AT CK TANG METRO PARAGON METRO MARINA22 words
-
Advertisement295 1996-06-15 19 The Maxim Condominium With the flair of an intimate European Hotel located in the heart of Metropolitan TORONTO which meet all your investment requirements! Wt Freehold Title Executive Suite Priced From S$ 1 089 888 Low upfront cash plus up to 80% Bank financing from S'pore Banks Prime Real Estate295 words
-
-
Page 20 Advertisements
-
Advertisement43 1996-06-15 20 I ONCE A YEAR AT j SIME DARBY CENTRE 896 Dunearn Road, Ground Floor (next to BMW Car showroom) i OPEN DAILY 1 1 .00 AM 8.00 PM FREE PARKING 1 0 fc^i Sw* pjpj BJBj^aj *WV M, _^J^| tiifi r o irpcim43 words
-
Advertisement154 1996-06-15 20 IP9 V flo. i Seller in Hon? Kon? for jg >5 I 1 SRH Findings 1989-1995 v^Mi prices inclusive of 3% GST** For 199Qj //w/m'vbtoMkifflkA maximum comfort, oil our mattresses \^3yw!/wJm WPI sre quilted with Seahorse Superior foam Our unique HEALTHY MATTRESS is I QVQti u&tt&r tridn mZmwwCmMw w l#154 words
-
-
Page 21 Advertisements
-
Advertisement177 1996-06-15 21 '^M^ fi? si's:! t^P" -The highest national income city in China. I Area 785 sq.ft to 993 sq.ft Rental Return Guarantee Well equipped tenant igpwa Example of Rental Return Big patio garden in J^P Fiattii Guangzhou, 60,000 sq.ft 1517th June, 1996 (Sat to Mob) Area 785sq.ft p ar u nn177 words
-
-
Page 22 Miscellaneous
-
Miscellaneous127 1996-06-15 22 THE HOUSE OF LIM GARFIELD iHK^^ffiSS^ ISSffIS BSSlSffi^^ I what's the: VI H£V VO^ R OIRTHIW I (anpth*v*amh. ?/N0 I HAVEN'T I I DON'T EVEN KNOU) 'I/- rJr BUT I IMAGINE A LOT I c?^^s II f JosT^ r(7W \.f < (SEENYOURMOM WMAT SHE LOOKS LIKE.. v n •OF TMEM127 words
-
-
Page 23 Advertisements
-
Advertisement181 1996-06-15 23 y^ BEE HUA carved furniture trader pte ltd i> n f%\ 845 Gey* ng Road #03-16 Tanjong Katong Complex IJ-C (Opposite Lebar MRT Station/Previous YOKOSHO) -JJJJ Singapore *****5 Tel: *****57 Fax: *****31 Business hours: 1 1 am to Bpm (Public Holiday as Nomal) DIRECT FROM OUR FACTORY IN CHINA mi181 words
-
Advertisement417 1996-06-15 23 GREAT TASTING I PEDIASURE: I I Ik FOR FUSSY I WJB LITTLE EATERS I WHO MISS I I I OUT ON MEALS. I 7 flP^l|BaH fvj A complete and |fl I^^^^ m I balanced meal Afl I in a glass. I Maximises jdtitt fefet growth and Bl j£ all-round M417 words
-
-
Page 24 Advertisements
-
Advertisement710 1996-06-15 24 I F^si.arlci^v^siLy^ Homemart Electrical Apollo M^jaurvEMdle Furniture (AERO) llZgxxMx-^cc^^ SO, Arlsurine Parade Rd Bile 2, #01>1139, N0.2 Havelock Rd, #O3 25T Joo Cliiat Complex #02-05 to OB (U.3Oam 9pm) (12pm 9.30pm) O lam 9.30pm) (Next to Furama Hotel) 1 Tel; *****28 1 Tel: *****20 Tel; 5386Q76 Aero Furnishing Centre has710 words
-
-
Page 25 Advertisements
-
Advertisement134 1996-06-15 25 wd Ik% wA wd I^% hm Fl II R^ KS j 1 w^\4 I SSSS9 s^r i I n<£&S k P I ir f irfii fli SALES OFFICE DEVELOPER: FY rffffWf}|t| I JOINTMARKETING AGENTS: SING DEVELOPMENT (PRIVATE) LTD IBlWlilli\ _A_ 96 Robinson Road, #03-06, U jgSnJH '°\™%r VT 77 SING134 words
-
-
Page 26 Advertisements
-
Advertisement708 1996-06-15 26 THIS AD WON'T HELP SAVE THE EARTH. (IT'LL SAVE YOU LOTS OF MONEY THOUGH.) SfcsS 1 NOW $1,738" uiS.""!^ B**8 NOWS6I6 97 fjf^aj usual: $3,000 NOW yl/Ovv \^L\f- «fwyf I I- iM~—A -i" i^^ih t B !t i I i aa«SLi; .;s r i^-m I r^i^^aal aa»!^^ aaaaJL^ Mollno Dining708 words
-
Advertisement33 1996-06-15 26 PEUGEOT 306 CABRIOLET Price: $159,800 with COE. Road Tax: $1,850 a year. OMV: $24,706 For enquiries and test drive, calk LeCar(tel: *****66) Monday Saturday: 9 am 6 pm Sunday: 9.30 am 5.30 pm33 words
-
-
Page 27 Advertisements
-
Advertisement360 1996-06-15 27 K Mf^fl CT^BvMbEEEE^ m—m—mm—* TVW«llBrick«t Study DMk tS£U K" Ma<ia In England BSoniy Colour Qrey Wonly wk IK-H& *990n1y Colour: Qrey BEEEEEEfe -JB D fl|» it A A Bacrttarya Chair Computer Chair O««niy W WL Varloua Colours j^o IjwJraulic WKydraulic JR *139c^ M6U«69>n ly 1 A) Exclualve SWW Deak f360 words
-
Advertisement855 1996-06-15 27 pQ F^ THIS "X llllß^ilUllf < B \I/ WEEKEND SPECIAL M 14 A/IDApV! C II EMPRESS MANDARIN MARINA }JHPHnIH WHlUllf 1 J V YANGTZE 2 SHAW OVERSEAS /§W K WbTll£ GOLDEN VILLAGE S JfL, nag,, ■ff^B/ tW^ EMPRESS MARINA S Bfi] JPwQ ilI 4iw A TRUTH ABOUT CATS I DOM855 words
-
-
Page 28 Advertisements
-
Advertisement903 1996-06-15 28 |^*^f^ |||^J ■JLJL.^I^ JiiilU"lA'iMiW¥ lipKTpG^ a Pamela Anderson Lee is Jk Sexy Futuristic Thriller from the iM f!S^ IFtalTllffiill ♦^creators of Trf%|l:^|K^nd /ff^jf\ "^U™^* 1 1 B"™l 1 ■^^*BVTT H aT H V IHHHH^^V H JrVT H V H l I UDOSONIWX CAFITOIIUI«NG SHAW LBSUK CAUOY CHNAIOWN CC'VIK IMISSHAWHOUSE ISTAMfORORD903 words
-
Advertisement660 1996-06-15 28 ■J^igj vfVCIwC/%3 iVilb/ ¥I Em In tho Mafia, thoro Is a unwritten codo of Honour.... Once you join, you're In for LIFE. SAT SUN SNEAK PREVIEWS t OVERSEAS/MANDARIN/GOLDEN VILLAGE AND SHAW CINEMAS ■riMMk ,fctf 9f^H» -3nf 'l«n^s«™ Haw ik Ml MMt Mwt .j. .Myjwi^Tiiv^^a^ .^^^i MBIk.. vnygygyd^Bj w^SV w^MB M-fji—660 words
-
Advertisement133 1996-06-15 28 m Killer Tornadoes L Hurricane Disasters Storm Strikes m at the P™ I Omni-Theatre t I LION Cin HOTEL SINGAPORE Comfortable Convenient Affordable 3 mins' walk to MRT Station [,^l *15 mins' drive to Changi Airport I 4P* fc 1 10 mins' drive to CBD, World j 1 Trade Centre,133 words
-
-
Page 29 Advertisements
-
Advertisement1756 1996-06-15 29 Bi jßj Bsfl Bi 1 1 11 B^^^^^By/jBHj 19^ I -I BBkfl ll^B 1 Hb ■laBI Bm il^^l i^ B^^H^HE^'^Psi^^HH^^Bß^^BßSi»™ i flfl^t «91 i BnH wfls T^^r3TT|H|' 1 1 *j PCt3^bl mSmm SmIEmIHELSEII,^ fJIIT>T"7Ti?/^^PIT7 JiSP J HT ra IpSbl*wp* ■ifl^r^ B I I I w. I I JH [PGI Km/1,756 words
-
-
Page 30 Advertisements
-
Advertisement315 1996-06-15 30 Ml I v^ IB vL B 11^ m B PARENTING EXHI AC TUC VC ADf m\ Admission Ur I tit TtMltl^H BHp^^ f f f J World Trade Centre lawr"^ Expo Hall 3A "14- 18 June 1996 1 2 Noon I^o pm Daily^ Motherhood Booth \j Copy Of Motherhood M315 words
-
-
Page 30 Miscellaneous
-
Miscellaneous1074 1996-06-15 30 .^■■■JV BTANJUKOK 8 pm. Presented by The Theatre Workshop of ("Alliance Francaise #11 Ms3k P?^m Festival Club (Stamford Cafe), Westin Stamford. Today: 4 pm. Sin- de Singapour. Comic sketches of Roland Dubillard and Jean TarWf B*fl mXmiW I mmvr mmYAw Am gapore singer-songwriter plays his original brand of music. dieu,1,074 words
-
Miscellaneous820 1996-06-15 30 ma d^^r* f^^ It^'M Mil I I I s^s^s^M BUSINESS DRESSING AND PERSONAL MAGE SEMINAR Marriot Hotel Ballroom 1, Level 3. Today: 2.30 5 pm. By image consultant Sara Dean representing House of Colour. Fee: $25 (including tea and refreshments). Call 733-3196. I PROBLEM SOLVING IN MATHEMATICS Bukit Merah Branch820 words
-
-
Page 31 Advertisements
-
Advertisement517 1996-06-15 31 btart planning roi tnernood Visit us at the Motherhood Exhibition '96 for your FREE "Nam from platog for prt CiUif w^ c^|^w|i imuSßDAfolic 11 acj^^H pares your body for the exdilttent of motJwKai: J provides you and your baby with the Motherhood Exhibition best posHe headstart. World Trade Centre Booth517 words
-
-
Page 31 Miscellaneous
-
Miscellaneous569 1996-06-15 31 Television CHANNEL 5 6.00 AM By Demand (Music) 7.00 The Gossip Show (Variety) 7.30 Movies Games Videos (Variety) 8.00 Hot Shots (Children's educational) 8.30 KMzercisel (Children's educational) §.00 Animanlacs (Cartoon) 0.30 Highlander: The Animated Series Isle Of Grans (Cartoon) 10.00 The Mask (Cartoon) 10.30 The X-Men Love In Vain (Cartoon)569 words
-
Miscellaneous513 1996-06-15 31 Television 10.30 Chinese Cinema I Cage man (Superimposed English/Chinese subtitles): A critically-acclaimed masterpiece scripted, produced and directed by Zhang Zhi Liang. It examines the lives of several ghetto-dwellers in metropolitan Hongkong. Stars Qiang Hong, Gu Feng and Huang Jiaju. 12.55 AM Chinese Cinema II Supernormal II (Superimposed English/Chinese subtitles/parental guidance513 words
-
-
Page 32 Advertisements
-
Advertisement737 1996-06-15 32 B I^BdHifIUMVvUBiJBMBdHnHUKnEMBi^BMUBHBtBHW ■L^m^^. j .^^^k. CAVctioani _r-A C IL T^Ti J I MSTDDU. SAVEJ/W.O/ I SjM sTTi^KT Jt\ f C I wcr vpdca I fasttext/multi- B^F^ 1 HI RAM/540 MB HDD/ 1 0.4" DSTN display/ systemyNkam/Germanwereo/one touch »^C~^Ny V I _J_ year warranty/Cosd A Nets Only r pH MAKE YOUR737 words
-
-
CLASSIFIED JOBES
-
Page 1 Advertisements
-
Advertisement318 1996-06-15 1 ______^__^^^^M I 606 Professional /Executive 609 Engineering 612 rr 615 Lecturing /Teaching 618 Tutoring 621 HealthCare j 624 Art /Creative 627 Marketing Communications 630 Sales 633 Counter /Telephone Sales 636 Customer Service 639 Agent /Broker /Trader 642 Hotel /Restaurant /Lounge 645 Beautician /Hair Stylist 648 Administrative /Clerical 651 Secretary /Personal318 words
-
Advertisement673 1996-06-15 1 CLASSIFIED SECTION 1 Join the STAMPEDE Jfll^and CHARGE J| towards these new > *Sl opportunities! w itm ™M enough i« gar for a career on^Sf JM* the fast tnckijp^jPi i^^f^k p 9 s 1-tt (ii Jr f fmnmSmtßm V mL Pgs 53 '46 I "sSrp^naig mar Moving You Ahead Singapore673 words
-
Advertisement320 1996-06-15 1 Catch the New Wave of HMI Education Virtually 'Net' yourself a MASTERS DEGREE at the ■k lß^ ake advanta g e of almost 1 00 years of Academic Excellence at the University of Paisley from the luxury of your own home. ■k mu university ALTRON Online brings you the opportunity320 words
-
-
Page 2 Advertisements
-
Advertisement833 1996-06-15 2 606 Professional/ 606 Professional/ 606 Professional/ Executive Positions Executive Positions Executive PosHioi Want a Career that will take you to new Heights? Accounts Officer With All Nippon Requirements: Airways, you're not GCE 'AV'O' Levels •7 tutt mavlna in the Dj P loma ln Accounting Computer literate with proficiency in rtgM833 words
-
Advertisement754 1996-06-15 2 606 Professional/ 606 Professional/ 606 Professional/ w Executive Positions Executive Positions Executive Positions SFabri steel Manufacturer of Commercial Kitchen Equipment Fire Fighting and Emergency Vehicles Opportunities to develop in a Company positioned for major growth regional expansion. SALES ENGINEER I REQUIREMENTS Some engineering sales experience is preferable Have good presentation,754 words
-
Advertisement1344 1996-06-15 2 606 Professional/ 606 Professional/ 606 Professional/ 606 Professional/ Executive Positions Executive Positions Executive Positions Executive Positions Venture Between a large leading Japanese Internationa! Warehouse FAR EAST I ;> Forwarding company and a local company with diversified shipping, ORGANIZATION Prorwarding. property and hotel businesses) Invites suitable applicants urgently requires: for the1,344 words
-
-
Page 3 Advertisements
-
Advertisement1141 1996-06-15 3 606 Professional/ 606 Professional/ 606 Professional/ nts Executive Positions Executive Positions Executive Positions a in., „I, in 1., I, 1 1., 1. 1., i i Operation MfINfIGER IMtoto Min S years experience in shipping as a marine engineer J^^V j^li I* Must possess M.OX Fifst or Second Class Engineer H1,141 words
-
Advertisement499 1996-06-15 3 606 Professional/ 606 Professional/ Executive Positions Executive Positions We are a public-listed multinational organisation with operations in Asia, Europe and USA. Our activities cover a wide range of Marine, Oilfield and Industrial engineering services and products. As a result of expansion in our CNC Section, we have vacancy for a499 words
-
Advertisement916 1996-06-15 3 606 Professional/ 606 Professional/ Executive Positions Executive Positions We are a regional Group of Trading and Manufacturing Companies with our headquarters in Singapore. We are inviting applicants for the positions of: SENIOR ACCOUNTANT/ ACCOUNTANT/ SENIOR ACCOUNTS OFFICER to assist the Group Accountant in all Financial and Management Accounting functions in916 words
-
Advertisement213 1996-06-15 3 606 Professional/ ns Executive Positions ACCOUNTANT Established European managed marine company, Jurong area.. The ideal candidate should: possess a degree in Accountancy have at least 2 years' relevant working experience have experiencee in computer ised accounting using ACCPAC System Call or Fax Resume: Tel: 266 8122 Fax: 266 7691 Minimum213 words
-
-
Page 4 Advertisements
-
Advertisement584 1996-06-15 4 ,606 Professional/ 606 Professional^ Executive Positions Executive Positions rSOH, WONG PARTNERS Certified Public Accountants (Member Firm of BKR International) Our practice is a medium-sized accounting firm located in Raffles Place. We are looking for dynamic and suitably qualified candidates to join our existing team of professionals. Excellent prospects for promotion584 words
-
Advertisement558 1996-06-15 4 606 Professional/ 606 Professional/ Executive Positions Executive Positions I Students Cart Service seeking suitable candidates for I I the followingHajgH Master in psychology. Preferably major in educa- I tional psychology Trained teacher with some teaching experience Ability to speak 2 languages GCE 'A' level or equivalent Active interested in working558 words
-
Advertisement578 1996-06-15 4 606 Professional/ 606 Professional/ Executive Positions Executive Positions di L Career Unlimited!!! We are an established executive recruitment and search firm in the Asia Pacific region. Due to business expansion, we would like to invite result-oriented professionals to join our dynamic team as: CONSULTANTS Pra-requisites:- Degree in any discipline, preferably578 words
-
Advertisement534 1996-06-15 4 606 Professional/ 606 Professional/ Executive Positions j Executive Positions THE SINGAPORE DREAM MARKETING AGENTS (Freelance) needed to assist in fulfilling that dream. As you know, part of the Singapore Dream is to venture abroad and to become an Entrepreneur. Some have the confidence in the Chinese market, but do not534 words
-
Advertisement390 1996-06-15 4 606 Professional/ Executive Positions CaU ARCHITECTS requires: Ik ARCHITECTS 21 DRAUGHTSPERSONS With knowledge of CAD Attracive remuneration package will commensurate with experience capabilities. Please call 339 3866 for interview FINANCE MGR. $46K$80K pa. Accountancy Degree/ Financial Accounting/ Treasury CONSULTING MGR. SB2K-SBOK Client/ Server Development and Project Management BALES MGR. S46K-SBOK390 words
-
Advertisement382 1996-06-15 4 612 IT Positions Call Linda: 223 6619 Fax: 223 0826 Software Engineers C/ Unix/ TCP/ IP/ ZBO. Analyst Programmer* 1 year RPG/ AS4OO/ Cobol/ Clipper/ LAN/ Oracle. Service Engineers Novell Network/ Unix/ Machintosh. Customer Service Executives DBase/ Dos/Machintosh/ Human Resource/ Payroll systems. System Analysts SC 10/ Unix/ Oracle/ AIX. Experience382 words
-
-
Page 5 Advertisements
-
Advertisement927 1996-06-15 5 609 Engineering 609 Engineering 609 Engineering 609 Engineering Positions Positions Positions Positions We are looking for people who are keen to establish a career with Singapore Press Holdings (SPH) in the field of Engineering and Printing. Successful candidates will be recruited and sponsored for the Singapore Polytechnic Dual Training Diploma927 words
-
Advertisement815 1996-06-15 5 612 IT Positions 612 IT Positions 612 IT Positions Jkmexitsn jSd^rol invites applications from suitably qualified candidates for the position of REPORTING TO Director of Technology MINIMUM QUALIFICATIONS Diploma in Computer Science/Electronics from a Polytechnic or Technical Institution. Good communication skills, both written and oral Demonstrates good public relations skills815 words
-
Advertisement544 1996-06-15 5 612 IT Positions 612 IT Positions I A leading Japanese CAD/CAM company I IB has immediate vacancy for B SUPPORT ENGINEER I ■ill Male in 8 a P° rean or permanent resident I -25 to 30 years old j In Diploma in Electrical/ Electronics Engineering I-I to 2 years' relevant544 words
-
Advertisement442 1996-06-15 5 618 Lecturing/ Teaching Positions I TOUCH Community Services? (Child Carel 66/88 East Coast Road #07-00 ORTH BMg. Singapore *****« i Fax: 346-7SM > We have the following vacancies I for a challenging career wit children. Attractive staff benefit for all positions. Salar commensurate* with experienc and qualification. 1. TEACHERS AND442 words
-
-
Page 6 Advertisements
-
Advertisement646 1996-06-15 6 615 Lecturing/ Teaching Positions Student Care urgently requires FEMALE TEACHERS (Part-time) '07 'A' level above Assist school homework for Primary Students in small groups Working on Mon. to Fri. (Morning or Afternoon) Staying nearby Choa Chua I Kang will be considered Interested, applicants, please call 789-2080 between 2pm. to Bpm.646 words
-
Advertisement665 1996-06-15 6 624 Art/ Creative 624 Art/ Creative Positions Positions ReaT«6rdatefcfe«r^Mn4yTsexrjenenoe -Ade to handte prrtiobfrcml I stattofriEh independent •Abteto work wahookxr-separators and pitas* I Wei versed with Mac soft/ hardwares Good communjgtjonj; I Creative and artistic flair Min 2 years experience Able to work I under dateline pressure Fast in Mac FreeHand665 words
-
Advertisement681 1996-06-15 6 630 Sales Positions 630 Sales Positions 630 Sales Positions 630 Sales Positions Grow As Fast As We B WJtk jtar^ §WBaw «*zi£Ls \,'g i:j^am<" so Si I I EjflQ BW At Esprit, we pride ourselves on creating lifestyles and QfIHJS fashion. We are currently expanding. Our new shop is yjgfl681 words
-
Advertisement878 1996-06-15 6 630 Sales Positions 630 Sales Positions 630 Sales Positions ASIA PACIFIC BREWERIES (SINGAPORE) PTE LTD Asia Pacific Breweries is a dynamic group of companies, operating some of the finest breweries in the world. Our famous Tiger Beer has won accolades of International Awards and has been acclaimed "Positively the Best878 words
-
-
Page 7 Advertisements
-
Advertisement603 1996-06-15 7 630 Sales PoaHions 630 Sales Positions *****111 itk We are an established company and a ySa leader in the Hair Care Industry. In I view of our expansion program, we j are currently looking for bßjpmrzMi gGSaaszHH 44) ■^a^B^B^B^B^Bß^Baaaaaaaaßaßßaaaaai a> Age above 21 years old '<y Level preferably with Certificate603 words
-
Advertisement682 1996-06-15 7 630 Sales Positions 630 Salea Positions Leading distributor™ designer fragrances seeks suitable candidate as SALES REPRESENTATIVE Minimum 3 years relevant sales experience in related luxury goods Maintain a good rapport with department stores and perfumery shops Supervise a team of sales promoters Good communication skills Good prospects for career ad682 words
-
Advertisement520 1996-06-15 7 630 Sales Positions An estabished financial institution requires SALES MANAGER/ EXECUTIVES Qualifications: Degree/ Diploma holder Good communication interpersonal skills Interested please write-in with full resume with a non-returnable passport-size photograph to: Human Resource Manager Tanglin Post Office P.O. Box 727 Singapore *****S jMfc^ Discover how DW ,H H5. ojwihbwwtfroin this520 words
-
Advertisement353 1996-06-15 7 630 Sales Positions CHINESE LADIES' BOUTIQUE Asst. required urgently. Age 18 35. Well paid commission. Call 344-6476 or walk-in at Parkway Parade, #02-24, Singapore *****9. CHRISTIAN BOOK SHOP requires Sales Assistant at Queensway Shopping Centre. Chinese, female preferred. Please call *****80 after 11am. BEAUTY ADVISOR CUM Sales. Speaks English Mandarin.353 words
-
Advertisement1057 1996-06-15 7 636 Customer Service 636 Customer Service 636 Customer Service 642 HotsV Rsttswwrtf Positions Positions Positions Lounge Positions A new Japanese restaurant gmananßUiuuuuuuuuuui^^^^uurauiKißiHßaaiaaHß """"""^^^^^^^^^^^V specialising in Okonomiyaki Teppanyaki requires: WAITRESSES m Republic National Bank -ss?a« Interested applicants, (Singaporeans) Republic National Bank enjoys an international reputation T^eis as being one of the1,057 words
-
-
Page 8 Advertisements
-
Advertisement558 1996-06-15 8 642 Hotel/ Restaurant/ 642 Hotel/ Restaurant/ 642 Hotel/ Restaurant/ Lounge Positions Lounge Positions Lounge Positions y r?we(Spove RVICEDiyAPARTMENTS A subsidiary wholly owned by City Developments Limited, is a New Service Apartment located in the city. Our 2 linking 4-storey and 10-storey blocks will house a total 0/ 97 apartments, comprising558 words
-
Advertisement627 1996-06-15 8 642 Hotel/ Restaurant/ 642 Hotel/ Restaurant/ 642 Hotel/ Restaurant/ Lounge Positions Lounge Positions Lounge Positions A new exciting INDONESIAN km^^S* \j RESTAURANT CAFE is looking for career minded professionals I fIMEVM to join our Food Beverage team I aH| V for the following positions: JJM.^^£^-\ Restaurant Supervisor WALK-INTERVIEW Waiter/Waitress Chief627 words
-
Advertisement377 1996-06-15 8 648 Administrative/ Clerical Positions Leading frozen food 1 trading company urgently requires: KMRIC ADMIN CL€RK GCE WO 1 level or equivalent Computer literacy with knowledge of Microsoft Window application Bilingual in English and Mandarin Able to perform clerical duties independently •Able to start work immediately We offer a challenging and377 words
-
Advertisement826 1996-06-15 8 648 Administrative/ 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions Clerical Positions fSfii n fiTiwii At OUB, our vision is to become a premier consumer bank. Our philosophy is to bring out the best in each individual who is keen in making banking a career. If826 words
-
-
Page 9 Advertisements
-
Advertisement1217 1996-06-15 9 648 Administrative/ 648 Administrative/ 648 Administrative/ 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions Clerical Positions Clerical Positions Clerical Positions WITH OUR PROVEN EXPERIENCE, WE CAN GIVE If you aspire to grow with an II jU UU L Uj U organisation that champions customer service excellence,1,217 words
-
Advertisement678 1996-06-15 9 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions tWmm IE II fit 1 1 ij I vl jk I w \m? You will provide administrative support to the Advertisement Sales Department Part of your duties will be to take minutes of Miles reports and handle phone678 words
-
Advertisement588 1996-06-15 9 648 Administrative/ Clerical Positions Trading company urgently required female 1) CUSTOMER SERVICE cum ORDER PROCESSING CLERK 2) ADMIN ASSISTANT Requirement for post 1: To key order processing co-ordinating of delivery schedules Update of inventory customer service GCE 'N7o' level or its equivalent With microsoft, excei word processing knowledge 5% days588 words
-
-
Page 10 Advertisements
-
Advertisement414 1996-06-15 10 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions BrMttkmik Offrtntittn 96 You'll learn grow with enthusiasm here. Location: Alexandra Distripark The Requirements: Minimum GCE 'O' level with PSC and 2 years' experience in a secretarial position Experience with OAsoftware such as Lotus 123, AmiPro and Freelance414 words
-
Advertisement471 1996-06-15 10 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions SHELL COMPANIES IN SINGAPORE (Careers To Match Your Talents) The candidates we seek should have A Diploma in Business Studies, Accountancy OR Good "A" level (2'A's 2'o's) with GP and Maths/Prin. of Accounts with relevant working experience Successful471 words
-
Advertisement1551 1996-06-15 10 648 Administrative/ 648 Administrative/ 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions Clerical Positions Clerical Positions Construction Co. in Eunos requires ACCOUMTS CLERK GCE 'O' level LCCI Certificate Bilingual in English Chinese Able to handle full set of accounts 2-3 years working experience Interested please call *****404 *****88 We are1,551 words
-
-
Page 11 Advertisements
-
Advertisement563 1996-06-15 11 648 Administrative/ 648 Administrative/ m Clerical Positions Clerical Positior IMMEDIATE VACANCY J WT\ ccounts I m I ssistant(Ref79) ■flHi (Accounts Receivable) S" Working as a part of a team, the successful I candidate will be handling Accounts Receivable. Requirements. S» GCE O' Level/NIC Accounting/Diploma in I Accounting or equivalent Self-motivated563 words
-
Advertisement500 1996-06-15 11 648 Administrative/ 648 Administrative/ is Clerical Positions Clerical Positions s •4" We are an established group of companies and have an immediate vacancy for the post of: CONFIDENTIAL I t SECRETARY 1 1 bhhbhbbbheibmel Pre-requisites: T "2 GCE 'OTA 1 level with a PSC ■X Minimum 2 years' relevant working500 words
-
Advertisement572 1996-06-15 11 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positions INT«A-MOTO«S INTRA-MOTORS (S) PTE LTD, an established automotive distributor and ISO 9002 accredited company has immediate vacancies at our new showroom and office for: ACCOUNTS ASSISTANTS You will assist in all aspects of accounting functions. GCE 'O' 'A 1 levels or LCCI572 words
-
Advertisement731 1996-06-15 11 648 Administrative/ 648 Administrative/ Clerical Positions Clerical Positior i I r— i sills Mount m Elizabeth Tsr Hos P ita| i S CLAIMS ASSISTANT 111 j ne claims Assistant will be responsible for all Z lil billing matters from physicians, hospitals, Z ■1 laboratories and handling queries on billings 2731 words
-
Advertisement608 1996-06-15 11 648 Administrative/ 648 Administrative/ is Clerical Positions Clerical Positions rE Wfßil «,J, 5 GC€ 'A'/'O' or LCCI certs IJ Computer literate, experienced with accounting packages H 1 -2 urs exp. in a manufacturing environment Retractive profit shoring bonuses 1 1 Inventory control and recording U Cost allocation and analysis I608 words
-
-
Page 12 Advertisements
-
Advertisement577 1996-06-15 12 648 Administrative/ 648 Administrative/ Clerical Position* Clerical Positions CBD Ship Managment Company requires LCCI Intermediate Bookkeeping Certificate Able to operate PC Fresh school leavers from Commerce Stream may be considered 180 Cecil Street #11-01 Bangkok Bank Bldg. *****546) TEL: *****73 FAX: *****78 CPA FIRM requires hardworking energetic 1) AUDIT ASSISTANTS577 words
-
Advertisement448 1996-06-15 12 OPERATIONS SUPERVISOR TO take charge of part time interviewers ft supervise Opinion surveys. •Min. GCE "0' level "Computer literate 'Bilingual (English ft Mandarin). Tel. 337 6117 extn. 16 (Mon.) TEMP. OR PERM. 2 Chinese Female Accounts $1K- $1.5K. Clerk $900- $1.2K. O.T. $500 p/mth. Below 30 yrs. Come #06-08 Orchard448 words
-
Advertisement550 1996-06-15 12 651 Secretary/ Personal 651 Secretary/ Personal 651 Secretary/ Personal i Assistant Positions Assistant Positions Assistant Positions K Keppel Bank H (A member of the Keppel Group) As a dynamic and fast-growing Bank, we are able to offer you a challenging career. We would like to invite applications for the positions550 words
-
Advertisement949 1996-06-15 12 651 Secretary/ Personal 651 Secretary/ Personal 651 Secretary/ Personal Assistant Positions Assistant Positions Assistant Positions Overseas Union Bank Ltd Invites applications for appointment asWe require: Minimum 3 GCE 'O' levels with credit in English and a recognised Private Secretary's Certificate or ITB/ITE Certificate in Business Studies (Secretarial Practice) Knowledge of949 words
-
Advertisement727 1996-06-15 12 651 Secretary/ Personal 651 Secretary/ Personal Assistant Positions Assistant Pofjffona r' atfjfcNEE SOON CENTRAL *> TOWN COUNCIL PUBLIC RELATIONS ASSISTANT wawewewewewaawewewaewaaaweWeWeWKawaeWeWt Our Town Council has a vacancy for the above position. This post requires a Chinese female with good writing skills and organising capabilities. The job requires the person to727 words
-
-
Page 13 Advertisements
-
Advertisement1730 1996-06-15 13 •84 Ttchntoil Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions J t b ScheringPlough, a research-based company QUALITY CONTROL DEPARTMENT; MATERIALS DEPARTMENT; engaged in the discovery, development, manufacturing QUALITY CONTROL1,730 words
-
Advertisement261 1996-06-15 13 ■MAINTENANCE TECHNICIAIM Reporting to the Factory Manager, the successful candidate will be responsible for^B I repairing and servicing of M&E equipment, the waste solvent treatment plant and the I scheduling of our preventive maintenance program. I Pre-requlsites City Guild or NTC with at least 2-3 years' relevant experience Knowledge of261 words
-
Advertisement125 1996-06-15 13 WAH HENG GLASS HOLDINGS PTE LTD The No. 1 Glazier in Singapore has immediate vacancies tor I SALES EXECUTIVES I Poly or NTC in Architectural or Drafting I Bilingual (English/ Chinese) I Class 3 driving licence I JUNIOR SECRETARY (To Project Manager) Full GCE '0' Level with passes in English125 words
-
Advertisement120 1996-06-15 13 |P"W"*"«""""*""*""""***""'' l ll l n|i I Diploma or ITC m Mechanical Engineering with experience I Strong analytical skills I Primarily involved in machine assembly, debuggng and installation I I OtherdutiesirKluo^n^inedesign.imprwefnentsandservice I NTC 20r3 in Mechanical Engineering I Involved in machining, assembly, debugging, installation and I servicing I I Diploma or120 words
-
-
Page 14 Advertisements
-
Advertisement1502 1996-06-15 14 BS4 Ttchnical Poijtiont 854 Technical Po»ition» 654 Txhnicd Po»ition» 684 Technical Potitioiu 684 Technical Positions 654 Technical Positions 684 Technical Posrti $2£*;<;> (Building blocks st^i -of i f your career V J J|> tegg&gg**2!m W' HDB has built quality housing for 86% of Singapore's population, WjM I^^. 1 IS Kp1,502 words
-
Advertisement35 1996-06-15 14 H Established >i Construction Company II urgently requires: "Iffi^tWffl" "DJJlfflifflJ" II Degree/Diploma in I Civil Building Minimum 3 years' I relevant site experience II H Please call Jenny Chin I Tel: 738 3785/ 738 213335 words
-
Advertisement711 1996-06-15 14 kmt 684 Technical PosHiont 654 Technical PoaHiont 664 Technical Poaitiom We are one of the leading automotive companies in the region Due to expansion, we have the following vacancies for young and dynamic SINGAPORE CITIZENS: fig" ENGINEERING ASSISTANT B9_B__-__ (Sub-contracting work) Diploma in Mechanical Engineering. Those with an EDB Croftman711 words
-
-
Page 15 Advertisements
-
Advertisement939 1996-06-15 15 Technical PotHiona 654 Technical Positions 654 Technical Po»ttiong 654 Technical Positions 654 Technical PoiHioni fe The Polyolefin Company (Singapore) Pte. Ltd. Build Your Future PRODUCTION TECHNICIANS On Our Strong Th j b Y\ J i* Successful candidates will report to the Production Supervisor and 4~" II All fill (111 AtlC939 words
-
Advertisement17 1996-06-15 15 n^ENGINEER 2. M&E COORDINATOR 3. QUANTITY SURVEYOR/ ASST. QUANTITY SURVEYOR Interested please call 255-4626 for an appointment17 words
-
Advertisement1034 1996-06-15 15 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions fl m^ fl fl BLjB Baae' Breakthrough wn J^J Ml [li Opportunities '96 HftP In search of new j| I^bL Technical Specialists flB *H Bjm9 Bfl B (Please specify area preferred) fl IFfl .Jv A. Surface Mount Technology1,034 words
-
Advertisement521 1996-06-15 15 654 Technical Positions OAF FRUITS COLD STORK P/L requires ■pMMjajMJMjMj, ■■■SiejpsM^Mßjf BMf •*.<■ TECHNICIAN with experience in refrigeration/aii'-con Fringe Benefits: Transport allowance Meal allowance Hoeptoießtioot surgical benefits AWS Coidroom allowance Uniform provided Interested, please call 7TSST2S I Printing Firm requires 1 Diploma holder or its equivalent Knowledge in ISO 9002521 words
-
-
Page 16 Advertisements
-
Advertisement596 1996-06-15 16 664 Technical Positrons 664 Technical Positions Guthrie Engineering (S) Pte Ltd I subsidiary of Guthrie GTS Limited) I GUQHpE We invite suitably qualified applicants for I I the position of: H I Diploma in Electrical Engineering preferably with some working experience p. The successful candidate will assist in the execution596 words
-
Advertisement394 1996-06-15 16 654 Technical Positions 664 Technical PosKions gnroofmitamn it nn.i a iqhi H «y£r e are a weU-estoblished and progressive engineering and construction company. We invite applications from suitably qualified candidates for the post of: I Paint I 1 Si TPFRVfcOR 1 Experience in supervision of blasting 1 D painting job394 words
-
Advertisement801 1996-06-15 16 654 Technical Positions 654 Technical Positions 864 Technical Positions 654 Technical Positions p ST Electronic Engineering Limited ST Electronic Engineering (ST E&E) is an established company providing m a diverse range of electronic systems integration and electronic engineering services. I Communication Control I Thf» anoointee will be responsible for supporting801 words
-
Advertisement515 1996-06-15 16 654 Technical Positions 654 Technical PosMam Fu Yu Manufacturing Limited j the largest Independent Mould Maker fk 1 S~~~& Plastic Injection Modder In Singapore JA vacancies f on i) ASST SUPERVISORS m 1 Secondary education Experienced in spray-painting (plastic line) Responsibilities include spray-; tainting, trouble* J shooting, job-coordination, etc ASST515 words
-
-
Page 17 Advertisements
-
Advertisement605 1996-06-15 17 imWk Technical Positions 684 Technical Positions lr> mi I.IJM ■j[j'|j| l j»'" EastGate Join The Largest CD Plant In S.E. Asia. EastGate Technology is the industry leader in volume manufacturing and product quality for CD-Rom/Video CD/ Musk CD in S.E. Asia since 1990. Witfi advanced technologies and manufacturing efficiency, EastGate605 words
-
Advertisement477 1996-06-15 17 684 Technical Positions 654 Technical Positions Due to expansion, Regent Motors Limited has a vacany for: The Job The person will be responsible for advising customers on service and repair matters. He will prepare quotations, monitor progress for servicing/repair as well as to liaise with surveyors, insurance companies and sub-contractors.477 words
-
Advertisement547 1996-06-15 17 654 Technical Positions 654 Technical Position! Mpppqi^— —^tpyg; p\ Established structural engineering consultancy practice requires Relevant qualifications required Preferably with 5 years experience in the design of building and/or bridge structures Candidates (with good academic results) without the experience but are keen in design works will be considered Please WRITE547 words
-
Advertisement596 1996-06-15 17 654 Technical Positions 654 Technical Positions 654 Technical Positions 654 Technical Positions sNR.TECHNiciANs/ f jmjKMt EMaW technicians JXHPfIMK Wmr jt, Jjhm, A (Day*/3 Rotating Shift*) W Mg M g M MgJjjfomU^ AA Requirements: M jHrnXlw^vWrW J§ Minimum NTC/ITC JLr mTaT If Malaysians with Technical M m W Diploma/Certificate with 5596 words
-
-
Page 18 Advertisements
-
Advertisement472 1996-06-15 18 657 Production 667 Production 657 Production Positions Positions Positions TECHNICAL OPERATORS Requirements: Secondary education :a=3r*— MANUFACTURING TECHNICIANS Qirppyp TJ» You will be responsible for setting 0 1 VJ rvIL U p f operating and maintaining A Q QTQT 1 A WPQ manufacturing equipment as well riOOIO irVi 110 a s472 words
-
Advertisement473 1996-06-15 18 657 Production 657 Production 657 Production Positions Positions Positions We are an established and progressive manu- facturer of switching components. Now we invite ZZZ an experienced and promising individual to switch ZZZ SUlAflfl on to a career with us as: ZZZ PRODUCTION SUPERVISOR Responsibilities: ZZZ Supervise a group of production473 words
-
Advertisement348 1996-06-15 18 663 Warehousing/ Inventory Positions Co. in Eunos Industrial Estate (Near MRT) requires: STOREMAN To handle plumbing, sanitary materials and products Interested please call 743-6056 for an appointment or walk-in to: 81k.1021 Euros Ava.3. #01-10 S *****0 666 Security Positions DAY SHIFT SECURITY Officers required at Ang Mo Kio vicinity. Interested348 words
-
Advertisement392 1996-06-15 18 663 Warehousing/ 663 Warehousing/ Inventory Positions Inventory Positions Fu Yu, the largest independent Mould Maker Plastic Injection Moulder in Singapore has vacancies for: STOREKEEPERS/ STORE ASSTS (sinoko/toas) Male/Female Physically fit CCE O/'N 1 levei M Minimum 1 year's relevant experience Responsible able to work independently Completed NS for male applicants392 words
-
Advertisement502 1996-06-15 18 666 Security Positions 666 Security PosTtuNm A major property developer, Straits SteamshipH Land, invites applications from suitable candidates for the position of: SECURITY OFFICER 9 Requirements: Previous experience in security or police workS Able to speak and write simple English Willing to work 3 rotating shifts Benefits: Attractive variable bonuses502 words
-
-
Page 19 Advertisements
-
Advertisement562 1996-06-15 19 866 -Security Positions 666 Security Positions 666 Security Positions 666 Security Positions (INCLUSIVE OF SHIFT ALLOWANCE) Male Singaporean, aged below 60 years Must have previous security, police or military ■Hi experience and be physically fit HH Must be able to speak, read and write English Work only an 8-hour shift562 words
-
Advertisement361 1996-06-15 19 675 Driver/ Transport Positions DEUVERY DRIVER Class 3/ 4 licence Hardworking Salary $900 $1000 Interested pis. call Mdm Koh *****01/ *****18 Du« to business expansion, SiatM Hock Corpn. Pte Ltd (Car Rental Division) has vacancies for DRIVERS Must possess class 3 licence Age 25 45 years Good knowledge of Singapore361 words
-
Advertisement447 1996-06-15 19 683 Part-Time/ Temporary Positions VACANCY FOR PART-TIME clerk open. Flexible afternoon working hours. Office located at Guillemard Road. Typing or word processing skills required. $650--$7OO/mth. Call Mr Lim Ee Cheong at *****88 during office hours. EARN $3000 monthly onwards. Freelance room rental agent wanted. Daily room listings clientele provided. Free447 words
-
Advertisement1189 1996-06-15 19 689 Other Positions 689 Other Positions 689 Other Positions 689 Other Positions 689 Other Positions National Library Board The National Library Board is a new statutory board which came into operation on 1 September 1 995 with the mission of expanding the nation's capacity to learn through the promotion of1,189 words
-
-
Page 20 Advertisements
-
Advertisement1003 1996-06-15 20 689 Othsr Positions 689 Other Positions 689 Other Positions 689 Other Positions SINGAPORE BUS SERVICE (1978) LTD The success story of SBS is the people MoveYourCareerAteadwithOneofthe Region's Best Pabßc Transport Companies s giv T7 XT your synergy. And watch your career cover new ground with SBS today! 1. Supervisor, Administration1,003 words
-
Advertisement1093 1996-06-15 20 689 Other Positions 689 Other Positions 689 Other Positions 689 Other Positions I Due to expansion program, we have immediate vacancies for the following positions: I I CLAIM ADVISORS ADMINISTRATION CLERKS J Diploma in Mechanical Engineering, GCE 'O' level GCE 'O' level/Certificate in Office Skills or equivalent At least 11,093 words
-
Advertisement302 1996-06-15 20 An established Interior Co. has vacancies for: 1) FEMALE SALES COORDINATOR Basic computer knowledge Preparation of quotations Handles all internal paper work Showroom sales Alternate Saturdays Off 2) ACCOUNTANT To prepare full set of accounts for associate companies Pis. contact SUSAN for an appt. or fax resume to Au Furnishing302 words
-
Advertisement553 1996-06-15 20 689 Other Position* 689 Other PotitiMg I G=D SMURFIT TOYO A new manufacturing Joint Venture betwggflßj two large multi-national companjNJ specialised in the printing of tobacco an? food packaging materials is looking JjSS suitable personnel to fill the position of:«« Requirements: "*fl Min. 'O' or 'N' level holder with 1553 words
-
-
Page 21 Advertisements
-
Advertisement779 1996-06-15 21 66* Other Potttiom 689 Other Positions 689 Other Positions JShtgapare invites applications from suitably qualified candidates for the position of REPORTINGTO J Director of Facilities Services, and Maintenance Supervisor AREA OF RESPONSIBILITY The Head Groundskeeper Is primarily responsible for the overall upkeep and appearance of the athletic fields including but779 words
-
Advertisement729 1996-06-15 21 689 Other Positions 689 Other Position* 689 Other Positions invites applications from suitably qualified candidates for the position of REPORTING TO Maintenance Supervisor and Head Groundskeeper AREA OF RESPONSIBILITY The Groundskeeper is primarily responsible for assisting with the over all upkeep and appearance of the athletic fields including but not729 words
-
Advertisement520 1996-06-15 21 689 Other Position* 689 Other Positions 689 Other Positions OUTSTANDING CAREER OPPORTUNITY 'Asian regional operation headquarters of a well-known Swiss packaging machinery manufacturer hae Immediate vacanclea for' i rapid expansion. If you poaaeae the below pre-requisites, contact us I 1 immediately! DESIGN ENGINEER J l l Min. Diploma/ Degree in520 words
-
Advertisement312 1996-06-15 21 689 Other Positions 1 UfERAFT SERVICE STATION in Jwrong requlrea TECHNICIAN/ DRIVER Completed NS Experience preferred but not necessary Class 3 or 4 driving licence essential Training will be provided Pleas* c«B Tel. *****88 for •ppoln tuiMi t REQUIRED 1. SCAFFOLDING SUB-CONTRACTORS 2. PLASTERS 3. SPRAY PAINTERS 4. GRINDERS B.312 words
-
-
Page 22 Advertisements
-
Advertisement1391 1996-06-15 22 r^ m m m^_^_____^ i J V 689 Other Positions 689 Other Positions TICKETING EXECUTIVES/ I At least two (2) years experience with I knowledge of Abacus and preferably I CTRS diploma or certificate. SALES ADMIN EXECUTIVE I Reportins to the GM, Sales Marketing. I You will be responsible for1,391 words
-
Advertisement167 1996-06-15 22 736 Tuition <fj> POPULAR learning is Fun! Well-equipped B,ooosq.ft. centre Experienced Full-time teachers Creative Curriculum Do Come Join Us for Holiday Camps Tutorial Claaaaa Please call: 294 9311 or Fax: 294 9322 Blk 677 Rangoon Road #03-00, *****77 Physics, Chemistry, Bio Alt, 'C, T Maths A/ts, Econs, Mgmt English, G.P.,167 words
-
Advertisement1250 1996-06-15 22 715 Forsign Education 715 Foreign Education THINKING ABOUT YOUR FUTURE?" I Hawaii's largest independent degree ■|§ll KffiM granting University HMMkJM BA/BS degrees in 40 fields; graduate studies (MBA/MSIS/MA) KJ^H I Comprehensive programs in Business ■■B Administration, Computer Science, Travel Industry Management (Hotel Management), Pre-medica! Studies HMMMM Accounting, Marketing, Economics, Vm1,250 words
-
Advertisement306 1996-06-15 22 764 FHimss/ Sports b Instruction AEROBICS/ QYM STEP stretch I workout for all ages. Tone Shape Up with us. faster results with dynabands/ weight/ circuit training. Call *****72/ *****90. 770 Floral Arrangement Instruction HANS FLORIST TRAINING CTB Tel: 337 1771 81-3O Fu Lu Shou Complex (Near Bugia MRT Station) Professional306 words
-
Advertisement1166 1996-06-15 22 ■HHmII Uft^H MasTBI EaV giBoo-737-1166 i !H»*ktmiti*t OiwiiHti TortatoJ BMTBRTAIMtISMT Property Financing /Insurance 432' I "*^!**l!t.t^----' I Open Houses/ Show Units 431f Bakeries /Delicatessens 5 ooi-08 CilyJSoutvWesl Catering 8 Houses-Sale 440 00 18 001 ■<» City SSouth-Wesl Foodltems 14 PieApts-Sale 441 Lounges /Discos /Pubs /Karaoke 17 (x»- 10 Orchard /Tanglin/HoSand1,166 words
-
-
Page 23 Advertisements
-
Advertisement384 1996-06-15 23 fiO^fiSDBDBD worn f& >^aPVMB' rflfifr^74l-4622|il I CATS. IHItIVYS AT ONLY $1 PER KG Sniff out this offer in CATS 1 MEWS, in Sunday Classified tomorrow. pis =»l| 8 tetering tetering Services by We offer Local and Thai cuiames for all occasions. Cell: *****45, *****08 Fax: *****46 (Lie-No. EL-W-93-044N-000) I m384 words
-
Advertisement307 1996-06-15 23 52 Antiques/ Collectors' Items CHINA ANTIQUE FURNITURE, CARVING SALE New Shipment Low factory price* to invest 800 pes Ching period carvings window, door frames, all sorts of themes very historical. (Ming) Huanghuali medicine/ jewellery boxes, silk embroideries, Hongrnu writing desk, official chairs, round dining table, bookshelves, cabinets etc. SEE TO307 words
-
Advertisement338 1996-06-15 23 23 Restaurants/ 23 Restaurants/ Food Outlets Food Outlts •T^Rj B^R^J HmHMH mkxwr nail Rj Ha^^^^a^SS^^^R>^^H 52 Antique*/ 52 Antiques/ Collectors' Herns Collectors' hems IMPORTANT AiNNOUNCEMENT The Renaissance Grand Sale Dramatic Price Reductions Don't Hesitate to BARGAIN 2 Levels Store-wide Renaissance Antique Gallery 469 MacPherson Road (next to Caltex Station) Tel:338 words
-
Advertisement853 1996-06-15 23 52 Antiques/ Collectors' Hems KOREAN CHESTS/ FURNITURE tale. Wide rang* at unbeatable prices! Rustic Collections, 384 Upp. Bt Timah Rd. (Off Jin. Asas). The Rail Mall. Tal: 7666-360 (12--Bpm. daily, except Mon.). TRANSFORM YOUR KITCHEN with a pair of Peranakan swing door* at only $460/ pair. Come see the many853 words
-
Advertisement630 1996-06-15 23 I >v fall [J^vlJ n 11 F£ fTDt?? Af] BB9aa^e9a^B^^BßaaaavT^^Bßa^Jß9M^^^Baa^KßßaHßa^S%u^^Bal I CALLING all koi hobby-ists; how would you hkr to have clear I water for your pond., with no washing required, all year around? H Universal Koi Pond Spccialitt Pie Ltd, a company 9 I specialising in constructing boih outdoor630 words
-
Advertisement347 1996-06-15 23 TIRED OF CITY LIFE? COME AND RELAX AT OUR RESORT-LIKE FISHERY FARM IN SINGAPORE Located on a 7 acre site and beautifullly landscaped, you can savour the peace and beauty of mother nature amidst our collection of prized Japanese Koi and tropical fish. (Open daily from 10 am to 10347 words
-
Advertisement500 1996-06-15 23 HAN'S QUALITY KOI The Koi Specialists Our 1996 Major Awards: Grand champion Ist runner-Up Grand Champion Young Champion (2 yrs. in a row) All these awards just confirmed the high quality of our Kois. Though our heads have swelled, our prices haven't. So visit us todayl No. 86. Lor 26-A,500 words
-
-
Page 24 Advertisements
-
Advertisement579 1996-06-15 24 64 CDs/lDs/Cassettes/ m Racords/Hr-Fi I rtoPKlfcSourKlEquJprnwrt nil jft DA DA RECORDS PTE LTD 0 MID- YEAR SALE LASERDISC 10% OFF (expect special offer item I) AIL RECORD VINYL 10% OFF (expect special offer item!) a^ ALL CD ALBUM AT $17.60 EACH DOUBLE CD ALBUM AT •38.00 PER SET ALL MR)579 words
-
Advertisement874 1996-06-15 24 64 CDs/LDs/Castottes/ Records/Hi-Fi i I. i i •aaß^B^^^ I BT^yBL Sm •fontrPn amp AC-3 toady) ctaDofcy Pro Logic Processor QTPSM PwartrnpfTHX) 130 watt xSchamtls of* 7000 Pomr amp 200 «a(ls 3 Cham* Of* 5503 Pwva«»«Mft)i4cl«imaNi ON MM Entry iwdPrtrnp GffMS Ei*ryl«rtPT»anipTiinar 0TP450 AiMtapMltSoWSWaPnaiv OFPiSSO Stataol Art SoW SMt Primp QFPMS874 words
-
Advertisement835 1996-06-15 24 66 Club M«mbTBhipB S RCI TIME SHAME. Australia freehold resort. Value $18K. Good buy $16K. 3-rm. 8 person. *****694 RCI TIMB-SHARINQ RESORT membership at Goa. Asking $12K neg. Call Ms Wong *****72 SELUNG SRC MEMBERSHIP. Interested buyara, plaaaa page: *****-478. Strictly no agents. SRC ORDINARY FOR sale. $51K incl. tranafar.835 words
-
Advertisement1111 1996-06-15 24 72 Musical 72 Musical 72 Musical Instruments Instrumants Instrumants H I USED PIANOS AVAILABLE L From $1,133 onwards* Made in Japan, Korea, Czechoslovakia and China B»"^^^^^ i AIVI AHA 9b BHbK From $500 onwards* W^^^T YAMAHA U Digital pianos 1 From $1565 onwards* Special Price cash carry __mmttm^KKmßmammm. F^mJL oCftRASS1,111 words
-
Advertisement671 1996-06-15 24 78 Photography/ Video Filming a MINT NIKON F-801 $550, SB-23 $90. Tokina AF 28-70 F2.8 $320, Nikon 100-300 F5.6 $595, 500 F8 Mirror Lens $680, Leica M6 $2800. Interested please pg:. 9-*****54. NIKON F4S. AF3B-108. Metz 60 CT4 Leica M3, Summarit 50/ 1.5 Meter. Pg. 9597-2305 or call 9828-4125. SELLING671 words
-
Advertisement884 1996-06-15 24 84 Sporting Goods 84 Sporting Goods NOW ONLY g SPEEDS SHIMANO WITH ALLOY RIMS 180 HUNDREDS Of SOLID LATEST MOUNTAIN 24". 26" FrTeSAFAR. CHAIR "MS IJOCLEAR! ALL COLOURS AVAILABLE """"\Amioß srectAi. nSwra^HL M PIEAStCAIX *^%=^B^^fcjp^^P\ASUlSSE SPECIAL MART OPENDAILY > &JISSF CONDO. OFF SWISS CUJB RD V TR»i 10AMTO8PM bUKJT TTNOOI884 words
-
Advertisement713 1996-06-15 24 108 Home Rtmjßjyng OCBION BTUOIO DTCauDI SPECUUS T Custom-made Furniture Direct from Factory •1 year warranty Showroom cum Factory at: No 4 Surtgei Kadut A*e (Thong Huat Brothers BWg) Tel: *****89 (6 lines) IMPORTED QUALITY- SILK beaded, patchwork embnoided bed apreada and cuahion covers aa well aa dacorativa Ji&usehold 'terns.713 words
-
-
Page 25 Advertisements
-
Advertisement849 1996-06-15 25 "'^fHP 8 Home Furnishing 108 Home Furnishing '^M| I J different from the rest .<* "ttfei I J arrange buy back scheme |1[ 1 realistic in our fixed price \ws-> 3 easy payment 90% loan 'cum I ...j....,..,,....^^ 5 REGENT CANE ;i cane specialist T* for project export contact William849 words
-
Advertisement927 1996-06-15 25 114 House 114 House Renovation/ Decor Renovation/ Decor M WIL 'S CONCEPT N DESIGN HI I 279 Balestier Rd «01 -1 3 Balestter Point, 5{*****7) INI Factory: 71 8 Lot 1 Admiralty Rd West 5(*****8) T«l: *****77 (4 Unas) Fax: *****77 FREE QUOTATION, FREE DESIGN, REASONABLE MARKET 1 PRICE, PROFESSIONAL927 words
-
Advertisement570 1996-06-15 25 118 Plumbing A ACCESS PLUMBING SVS. 24 hra. emergency service! FAST FAST RESPONSE! Having problem with your plumbing, DONT WORRY ONE STOP PLUMBING SERVICE G'teed. Efficient ft Reliable We specialise in all kinds of plumbing. Manual auto machine for all kinds of chokage Main pipe hole WC, sink gully choke570 words
-
Advertisement553 1996-06-15 25 120 TV/ Video/ Hi-Fi Equipment AA AERIAL ANTENNAE 6 channels Antenna system with Installation. Japan products $280 UHF Antenna with Installation For Premier 12 Channel $250/Indonesian Channels $280/S.C.V Pay Channels $280/TV Ext. Point $507- up Repair Service Antenna $50 For immediate appointment call *****807. *****888. *****02 LAM ELECTRONICS (Mr. Lam)553 words
-
Advertisement591 1996-06-15 25 150 Domestic Help 150 Domestic Help 150 Domestic Help 150 Domestic Help Available Available Available I Available I dftk Your FAMILY Deserves The BEST! JL^MI y An agency providing Christian maids for better homes dSti&J&&AL. The Advantage: Strict Control Specially Picked Trained Baby Sitters, y§l /Villin 9 To Care lnvalid591 words
-
Advertisement164 1996-06-15 25 TEU6BJUI New BioData, Just Arrived Personally Interviewed Well-trained/Fast Delivery Guarantee Replacement s Good Backup Service mmHkmMm-IMm taMwu ILMaa LMpei I jfoOT -T^E3^| F.C. h|^ v M i;J d Pv^^J INDONESIAN \VtR fiJß9ft i uuu DO£O #04-01 S'pore Shpg Ctr Opp. Dtioby Ghaut MRT (N1 FILIPINA Welcome to a wide selection164 words
-
-
Page 26 Advertisements
-
Advertisement350 1996-06-15 26 ISO Domestic Kelp 150 Domestic Help V Available Available SERVICES" BEST TRAINING f p \fti m 1 "Mf <~n^b 'M t. Filipinojndonesian :I Sri Lanka 6 WglM' mdID FORCE ALL-IN PACKAGE FEE. NO GIMMICK. Video viewing Strict training/discipline 5 Provincial housemaids Ex-abroad experience Unlimited replacement For housekeeping/babysitting/ fc°y Persorial intervtewB350 words
-
Advertisement465 1996-06-15 26 150 Domestic Help 150 Domestic Help Available Available BLa^BJß^a^AwiaiJßMhi^BVJßß^ nPtJP^ eyl Filipino Indonesian I Sri Lanka i y Bio-Data Available ■W^ Wi9 ara nof paYfact-/Wabgirjr^| We do not need a big advert to tall you how good our maids art. Check us out at Blk 1 35 Jurong East 304465 words
-
Advertisement668 1996-06-15 26 5 150 Domestic Help Available (C-3621O1) INDONESIAN JUST ARRIVED WIDE SELECTION OF 810-DATAS I Indon/ Sri Union/ FWptno I At *JF B •^■'■aP^BF i ALL IN y^ Park waw ParadeM* Newway Employment Agency Many new biodatas. Best native Javanese, Good attitude work. '07 'A' level, good learning abilities Ex-Malaysia experience668 words
-
Advertisement552 1996-06-15 26 150 Domestic Help Available TRANSFER (MOON) New Indon Filipina maids avail. Pis. call: *****20 Em-Pro (C-*****1D) TRANSFER/ NEW INDON 7 Filipino maids. Trained. Wide selection. Goodwind *****97 (C-3039-01G). TRANSFER INDO MAID for immed. transfer. Pleasant. 25 yrs. Call Allbest 733-9166 (C-*****1-B) 2 FILIPINAS FOR transfer. Care of aged/ children/ cooking.552 words
-
Advertisement907 1996-06-15 26 154 Factory/ 154 Factory/ Warehouse Sales Warehouse Sales BRANDS FOR LESS Imported American Italian Designer Wear for the whole family at affordable factory prices. 3C River Valley Road #02-27 The Cannery, Clarke Quay Tel: 334-5583/ 334-6639 (2pm. to 9.30pm. daily) a null!! WAREHOUSE STOCKS TO Clearl Hundreds of USA/ Belgium907 words
-
Advertisement571 1996-06-15 26 158 Garage Sales MOVING HSE. SALEI Electrical items, furniture in good cond. New dining set fridge from new house purchase. 56 Pasir Ris Terrace. Ipm spm. Tel: *****48. MOVINfI SALEI BEDROOM set. cupboards, glass partition, sofa set, split aircon unit. Blk. 629, Be dok. Res. Rd., #09-1624, Sat. 3 spm.571 words
-
Advertisement282 1996-06-15 26 160 Gold/ Pawn Tickets ABSOLUTELY HIGHEST PMCtt offered for all kind of Jewellery, Gold, Diamonds, Watches, Rolex Pawn Tickets. #03-02, People's Park Centre. Tel.: *****11. 162 Goldsmiths/ Jewellery WE HAVE READY set Emerald jade for wholesale. Interested pleasecall96l6_ll7l/*****38 166 Health Centres 48 MINUTES MASSAGE for $36 #03-30 Orchard Plaza (Rear282 words
-
-
Page 27 Advertisements
-
Advertisement785 1996-06-15 27 Bookkeeping/ Secretariat/ Answering Services WILL HANDLE YOUR co./ part iiership mthly a/cs with GST/ tax with reliable financial reports at .an economical rate. Call *****44/ *****759/ pg *****486. TOW COST COMPUTERISED Accounting. Unbelievable price. Call *****98/ pg. Sheryl 9 *****60 -and have a pleasant surprise! $1600 INCORPORATION OF lid. Co.,785 words
-
Advertisement1658 1996-06-15 27 209 Business 209 Business 209 Business Opportunities Opportunities Opportunities i PARTNER REQUIRED I NORTHERN PACIFIC RIM We have just appointed a partner We produce from our patent in Japan and are now looking for applied for machinery beautiful a person with a marketing crystal clear ice statues and decor, business1,658 words
-
Advertisement1134 1996-06-15 27 221 Computer 221 Computer 221 Computer 221 Computer 221 Computer Products/ 1 Services Products/ Services Products/ Services Products/ Services Products/ Services m POWER AND PERFORMANCE MAT AFFORDABLE PRICE! cho.ce DONT G0 HOME WITHOUT iTi" m&&mm_ ack By Office PowerMate Vl OO '"afi WB Intel Pentium 100 MHz A SR^5 TJCXftSL^1,134 words
-
Advertisement532 1996-06-15 27 221 Computer Products/ Service* IMD PERIPHERALS PTE LTD Sim Urn Square #03-64 AMD 100/133 CPU $47/»86 Pentium CPU (Box Pack) tSfac-t 4MB/ BMB SIMM (60ns) $35}77 4MB/BMB EDO SlMM(sons)sWi6 16MB SIMM (60ns) Slfs Quantum 1.2/2.5G8 (8.F.) $288*418 Intel Triton Pentium Board -4138 512K8 Pipeline Module $49 S3 Trio64V+ MPEG/ SVGA532 words
-
-
Page 28 Advertisements
-
Advertisement1209 1996-06-15 28 -M— -_^1 i; 1 sass-^ 221 a^ 1 ssa^,*- 221 gss r 8. re M sss**- sasg-^l 221 r s. rel M i T2l »rs. rei sasyi,*- 221 ssy^^ wJrrTty warranty inclusive nilo f A J J J Rosoiution isoo x 1280 1 I 4 High Resoiution Colour DotVtch I1,209 words
-
Advertisement424 1996-06-15 28 FREELANCE C PROGRAMMING and debugging available. Call Lan guage House Pg: *****708 MASTER, PROVIDES FREEL ANCE programming in C, Foxprc Clipper. Pg Ms Yang 9701-3363. NOTEBOOK SHOCKI PATIUM 120- $3,090. Patium 100- $2,899 Patium 76- $2,750. Pg: 9-587-5592 OFFERI SELECTED OftlG. game for $35 each (3 for $100) at Thi424 words
-
Advertisement325 1996-06-15 28 236 Industrial Equipment/ Supplies SALE/ RENTAL: 100 units 1-10 tons Forklift, Bar Bender/ Cutter, A 16-400KVA Generator/ Welding I- Set. SMC *****89. I DAI KIN SPLIT AIRCON. 18,000 s BTU. With accessories. Working e condition. Selling cheap. *****75 FOR SALE. ONE new 'EMC Dip lead former machine (DA-1000). >. Contact325 words
-
Advertisement393 1996-06-15 28 239 Packing/ Storage/ Delivery/ Removal HONG HENG TRANSPORT 30 ft. box lorry, house/ office removal boxes for sale Reasonable fee Free quotation *****80 day/ night. YIP TRANSPORT. HOUSE/ office removal, safe/ piano/ organs, disposal storage service. Reliable workers. 24-hr. *****62/ *****61 A BUDGET PRICE. Immed. service. House/ office removal disposal393 words
-
Advertisement518 1996-06-15 28 241 Phones/ Faxes/ 241 Phones/ Faxe*' 241 Phones/ Faxes/ Pagers/ Special Pagers/ Special Pagers/ Special Numbers Numbers Numbers k hf^ FOR THREE DAYS ONLY AT $90.64 SAVE $51.51 Get lucky this weekend with the Avont AI-898N pager! NOW ONLY $90.64 (USUAL PRICE $142.14). That's a savings of $51 .501 Plus,518 words
-
Advertisement677 1996-06-15 28 prices Drop Aqain!ll| Rimited^BßßH| t^StO C k Ji|li|ijlfl^^ KttflUd PKOMOIIOX PACKAGE 1 GRAVIS PENTIUM 100MHz SYSTEM I'^^1 •BMB Memory RAM W/256K Burst Cache WHS^WSSSSSWJ^k •1.44M8 FDD /850MB Hard Disk t^L Mm»llW£xn% PCI S3 l MB SVGA Card w/MPEG ftfi'iffiyßtHW Mini Tower Case Keyboard EfflStiii 1 4" SVGA Monitor(o.2B) 5 Y677 words
-
-
Page 29 Advertisements
-
Advertisement1684 1996-06-15 29 302 Aria For Sale 302 Alfa For Sale 302 Alfa For Sale 302 Alfa For Sale 302 Alfa For Sala ALFA 1 45 t I FOR THE DISCERNING ELITE WISHING TO EXPRESS THEIR SRORTIVE PERSONALITY. Pre-tensioned Safety Airbag Seat Belts Sound System Ultra-Ergonomic I Spacious Interior Cockpit v. is r1,684 words
-
Advertisement265 1996-06-15 29 305 BMW For Sale '84 MODEL BMW 520i, auto. COE 6/'2003. New tax, CD car kit. Well kept. Tel. *****55 '86 BMW 3201. Auto. 4-dr. COE 10/'2003. Maintained by agt. Well kept interior. Tel: 440-4238. '88 3201 AUTO. 4-dr. COE 11/7003. 2 owners. Leather seats. 100% tip top cond. Tel:265 words
-
Advertisement512 1996-06-15 29 307 Citroen For Sale 307 Citroen For Sale 307 Citroen For Sale You Can Buy Upgrade to a A Skid can happen anywhere. V*"* aTRC^#* e mistake !a P se of r\jPM*Mp&<€fa<* r atloi k or uneven weight The only car with distribution is all it takes. IN A SKID512 words
-
Advertisement271 1996-06-15 29 310 Daihatsu For Sato SPORTY MID '87 Charade GTTi 1.0. 3 doors. Turbo. Full body kit. Turbo timer. Expensive s/rims. See to believe. COE 7/7006. Asking $46,800. Tel: 736-0800. 3 UNITS OF Daihatsu Hiiet 1.0 pte. plate dO/'B7 with COE till 2009, 5/'B9 3/'92). Can go Malaysia. 7 seater. S/rims.,271 words
-
Advertisement245 1996-06-15 29 310 Daihafu For Sato NEAR '81 CHARADE. 2K paint. Full accessories. $12,800. Deposit $2800. View: Lot 58 Kallang Auto. THE BEST '88 Black Turbo. Superb CD hifi system. Pg. owner. 9-*****31/ Tel. *****69 07/88 CHARADE 1.0 CX, green, alarm, s/rim. Tip Top Cond.l $22,000.. neg. Pg: 9-*****31 1 OWNER 10/89245 words
-
Advertisement858 1996-06-15 29 310 Daihatsu For Sale 8/81 CHARADE 1.0 manual. 5 dr. COE '2000. Tax 10/96. Tip-toe cond. Call *****66 8/90 CHARADE I.3SG. 4 dr. 1( valve. 2 owners. New tax. Asking $34,500. Interested Pg: 9-*****61 7/92 CHARADE SGI .3. Fuel in jection. CD changer. $50,500 neg No agent. Pg: 9-*****17. 8/88858 words
-
Advertisement708 1996-06-15 29 316 Honda For Sale--1 owner '90 new model Civic 1.5. Maroon/ grey. Accident free. Rims. New tax 12/96. Hi-fi. $40,900 up. Tagore Lane 6th, *****18 Bestway f Buy Sell I Any Model of Private I ICar. PARRCOE Car. I All Honda Used Car Owner*)! WE BUY/ SELL AU. MODELS '89708 words
-
-
Page 30 Advertisements
-
Advertisement818 1996-06-15 30 "JT2 Fiat For Sale 312 Fiat For Sale 312 Fiat For Sale 312 Fiat For Sale for everyone who's :r m 0 wanted an m> Italian love affair^-a^p^^ htm Tt-rm ami BbHbV V^^r^^^^^^am^^aw^^^"^ aW E FIAT BRAVA v <$M& T^e car that conquered Europe |D|QT HAT BRAVA CI I H818 words
-
Advertisement646 1996-06-15 30 1 OWNER '94 Accord 2.OLX auto. ABS. Expensive hi-fi, leather seats, s/rims. Accident free. *****10 1 OWNER '90 model. Civic 1.5. Fully auto. Tax 11/96. SBL plate. $39,800. 736-0800/ *****907. 1 OWNER '94 Accord 2.OLX Auto. Bidded no. Mileage 20,000 km. Orig. paint. *****22/ *****858 1 OWNER 6/93 Honda Prelude646 words
-
Advertisement730 1996-06-15 30 316 Honda For Sale 7/94 ACCORD 2.0LX1. Auto, green. 1 owner. ABS. Bidded no. Pg. *****-002 no agt. '79 HONDA ACCORD. Aircon. COE 11/2001. Good condition. Selling $11,000. Call *****56 8/87 ACCORD I.OEx auto. Maroon. S/ rims. Tip top cond. Nice no. $19.8K. Pg: 9-*****18 Owner 8/87 HONDA ACCORD EX730 words
-
Advertisement732 1996-06-15 30 317 Hyundai For Sale IST PAYMENT $2328. $18,888. '89 model Stellar 1.6 GSL. PARF $11K. 2 owners. Tax 10/96. Tel: *****55. Can trade-in. 10/87 HYUNDAI STELLAR 1.6 auto. (Nice no. EFI2O). S/rims., hi-fi. Tip top cond. Lot 22 Aljunied Used Car Ctr. 2/91 2/90 Excel I.3LS. Full accessories. Well kept.732 words
-
Advertisement1047 1996-06-15 30 317 Hyundai For Sale 6/'B9 SONATA 2.4GLS. Auto Sunroof, PARF $44K. Askinj $51.8K. Tel. *****00 6/90 EXCEL I.3LS. 4-dr. 2 own ers. Orig. cond. $31,000. Cal *****27/ *****057 7/91 ONE OWNER Hyundai Elan tra I.6GLS. Tax 12/'96. CD $43,800. Tel. *****11/ 9-*****88 7/'9l 1.6 AUTO. 1 lady bosowner. Tip top1,047 words
-
Advertisement931 1996-06-15 30 324 Mazda For Sale 324 Mazda For Sale 324 Mazda For Sale 324 Mazda For Sale 324 Mazda For Sale sss=^s== i I NEAR '82 MAZDA 323 1.3, 4- door, COE 2002. New tax, 2K paint. Deposit $4K. Tel: 566-3557. NEAR '90 Famili 1.3, 16 valve. 2 owners, power steering/931 words
-
Advertisement184 1996-06-15 30 325 Merc edet For Sale (A sutetfary of Orchanl Craft Pte Ltd) '96 MODEL IMMEDIATE REGISTRATION E200&E230 IMMEDIATE DELIVERY •With COE package High options Wide range of colours i Prompt after sales services 12 month warranty BRAND NEW MERCEDES C2OO 09 Immed. regn. q, Leather seats 0 Q*) Twin airbags/184 words
-
-
Page 31 Advertisements
-
Advertisement538 1996-06-15 31 325 Marcadas For Sato 325 Marcadas For Sato I [Best deal for new Mercedes! E2OO E230 ClBO S2BO C2OO 5320 C220 S32OL ■^■^■f e^L^^B Bm*"*bT^ **^k aV T t^J IBj H^ ..jL|jij]||||iiiiiMiMMß«^B»^B»^B]a^B»^Ba^B^BJß^BM flsfefc qo ■MwOiimi? Prices with COE. High specs. Immediate delivery. I Tel: 469 9292 1 lb MERCEDES 200.538 words
-
Advertisement412 1996-06-15 31 10/94 C220 BLACK. Auto. Pitt owner. Guaranteed accident free. Mileage 23,000 km. C&C maintained. $185,000. Tel. *****54. 2 UNITS '84 MERCEDES 190E facelift to '92 model. COE 6/2003. Silver, grey. Tip top cond. Low deposit/ trade-in. $84,800. *****88. 3/94 E220. AUTO. 1 owner. 2nd car. Metallic rosewood. Leather seats. 20,000412 words
-
Advertisement975 1996-06-15 31 325 Marcadas For Sato MID 'SO MERCEDES 200, manual. COE paid. New engine. Good cond. Interested tel. *****52 MUST VIEW! 'SCJ' plate mid '93 Mercedes 300SL auto. 1 owner. Brand new cond. *****33 NEAR '78 MERCEDES 200 manual. MB tex. COE 2002. White. Beautiful cond. Tel: *****88 BKW. NEAR '84975 words
-
Advertisement833 1996-06-15 31 325 Marcadas For Sato '88 190E. AUTO. Converted '93 model. Expensive hi-fi. COE till 9/2003. $76K. *****93 '86/ '92 MERCEDES 300SE auto. Nice number. 1 owner. COE 2002. Leather seats. Tip top. *****303 '86/92 MERCEDES 200. $83,000 0.n.0. Tax Nov. '96. Good condition. Accident free. Tel. 7822-022. '87 LATE E2OO833 words
-
Advertisement1912 1996-06-15 31 326 Mitsubishi 326 Mitsubishi 326 Mitsubishi For Sale For Sato For Sale HnrriPlWil 1.3(M) $89,800/- «.6(M) $103,800/--■JLlifiKifl 1 .3 (A) $9 1 ,800/- 1 .6 (A) 1 06,800/TftfiM s Mmti£_i"£9 »59, Upper Serangoon Road #0 1 -02 Hougang Court y^&fTMT&Tf Singapore 534*90 Tel: *****77 <g* NEWTON AUTO PRESENTS THE ALL-NEW1,912 words
-
Advertisement987 1996-06-15 31 328 Nissan For Sato MID '93 SUNNY 1 .SEX. S/rims. Tax 8/96. 2 owners. $62,800. Lot 9 Kallang Auto Ctr. MID. '94 SUNNY I.SEX. 1 own er, 100% accident free. $69,800 0.n.0. Tel. *****13/ 9-*****32 NEAR '84 PULSAR 1.0. COE. Air con. Hifi. S/rims. Tax 9/96. Selling $17,500. Pg.*****199. NEAR987 words
-
Advertisement909 1996-06-15 31 328 Nissan For Sato 2/79 DATSUN IOOA. 3 owners. S/rims. $10,900. Tel: *****53. 330 Opel For Sale 1993/12 OPEL ASTRA 1.4 Stationwagon approx. 21,000 km 5570,000, 0.N.0. incl. Cover, Sony Radio with CD Player, bicycle carrier for 3 bicycles, thief alarm, tax 30.11.98, very good condition. Agent maintained (1 owner).909 words
-
Advertisement983 1996-06-15 31 334 Proton For Sato PROTON WIRA 1.8 GLi Manual 4-dr. 9 mths. Orig. cond. $*****. Accident free. 1 owner. *****927 1/91 PROTON SAGA 1.5G1. 1 owner. Power steering/ window. $37,000. Tel: *****17 1/94 WIIA I.SGLi. beautiful light green, manual sedan. Ist lady owner. Call 257-2084 1/98 WIRA 1.6 XLi. Manual.983 words
-
-
Page 32 Advertisements
-
Advertisement863 1996-06-15 32 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot For Sale 332 Peugeot^Sale^ of French flair. Only at Le/Car! (in \t Dt> r <* yym^fSS^S^^^m863 words
-
Advertisement1897 1996-06-15 32 Si^uSru^r Sle 341 Subaru For Sale 341 Subaru For Sale 341 Subaru For Sale 341 Subaru For Sale 341 Subaru For Sale 3 YEAHS ROAD TAX ■ku Hskk L^BT^^dMßt m p reza 5 jportj Edition Buy the new Subaru Impreza GUM) for just $99,800 iinci. cob and enjoy free road1,897 words
-
Advertisement214 1996-06-15 32 4/98 COROLLA 1.3XL1 $83.8K. 8/90 Corona CD auto $45.8K. 11/89 Corona CD manual $36.8K. 12/88 Corona CD auto $29.8K. One owner. Lot 18 Kallang Auto '94 TOYOTA COROLLA 1.6GL1. Manual. Beautiful cond. Agt. maintained. Owner upgrading. No dealers pis. Asking $82,800 neg. Contact Pg: *****-710 H/p: 9710-4462 END '82 STARLET214 words
-
Advertisement656 1996-06-15 32 342 Suzuki For Sale 342 Suzuki For Sale I PANDAN CRESCENT (OFF Champion MotorB WEST COAST HIGHWAY) S r An Inchcape Company SINGAPORE *****2. F H TEL: 774 9773/4. 778 1010. OPENS OAILY 9AM-6PM SAT/SUN 10AM-4PM. http://www.commerce3sia.com/championmotors 344 Toyota For Sale 11/93 CORONA 1.0 Manual 1 owner, 15" S/rims. Sound656 words
-
Advertisement819 1996-06-15 32 344 Toyota For Sale 1 OWNER 2/81 Corolla I.6GL manual, tax 1/97, metallic grey, full accessories, tip-top. *****08 1/82 COROLLA I.BGU. Auto. 1 doctor owner. Tip top cond. Tel: *****11/ *****552. 10/88 COROLLA I.3XL S/rims, CO changer. Tax 9/96. Well maintained. 2 owners. Tel: *****70. 10/88 TOYOTA COROLLA XL 1.3,819 words
-
-
Page 33 Advertisements
-
Advertisement952 1996-06-15 33 344 Toyota For Sale 344 Toyota For Sale 344 Toyota For Sale 344 Toyota For Sale aaaaaaaa— —^^.mj ssssssssssssssssssssssss sssssssssssssssssss July COE results ii^iMiJij I=l 1 ,,.^""1 j I—^9r1 —^9r moving COE prlc» Up/down Quota Bids Top bid Average* Small cars (I,ooocc and under) $18,20o"~+$1,302 252 414 $27,188 $18,922 Medium952 words
-
Advertisement743 1996-06-15 33 347 Volvo For Sale STSS VOLVO 240 auto 2.0. PARF $29K. Excellent cond. ABS brakes. Sell $42.3K. Call pg. 9-*****24 8/88 VOLVO 24OQLE auto. PARF $30K. Silver. Tax 7/'96, immaculate cond. $43,500. *****88. 8/93 VOLVO 940QL auto. 1 owner. Nice number. Highest offer secures. Steven *****00/ *****139. '90 VOLVO 7400LE743 words
-
Advertisement682 1996-06-15 33 351 Classic/ Vintage Cars '78 CLUBMAN, IMMACULATE cond. Fully refurbished. $14K neg. Call *****64/ 9-*****76. 353 Sports/ Coupes/ Cabriolets 4793 HONDA BEAT convertible. Cute economical. $80,000. For viewing call *****032 354 Jeeps/ 4-Wheel Drives END '88 LAND Rover Discovery. Manual. Orig. Camel Trophy rims. Pg: 9-*****50/ Tel: 9-*****38 1983 SUZUKI682 words
-
Advertisement472 1996-06-15 33 aassssßSSSssssKS 357 Q-Plate Cars Q' 'S3 SAAB 900S 2.0 auto, low mileage, agt. maintained, beautiful cond. Showrm. Call *****00 •O" 'S3 TOYOTA Corolla 1.6GL1 Auto. 1 owner. 16 valves. Asking $76,800. Loan/ trade-in. *****29 Q PLATE WANTED. Any pte., PB bus, commercial. Kwang Chun *****00/ Mr. Chan *****00. O '88472 words
-
Advertisement492 1996-06-15 33 346 Volkswagen 346 Volkswagen 346 Volkswagen 346 Volkswagen 346 Volkswagen For Sale For Sale For Sale For Sale For Sale SSS=SS^SS=SSK SSSSSSSSSSSSSSS^SS jA JJJ* Foll-sixe driver's side M Hft O r^ airbag {inflates within M Lm m* E j i*ew 30 miliseconds 1 RU Front and rear JS.fl^^i on impact).492 words
-
Advertisement243 1996-06-15 33 381 Scrap Vehicles ALL BRAND CARS export Mercedes, BMW, Volvo. Ricky Tay *****18/ *****19/ *****818. ALL BRANDS CARS wanted for scrap/ export. Cash payment high price. Leco Motor *****06 ALL HIGH PRICE for PARF scrap/ used/ *Q7 SZ cars for export. Kwok *****42/ *****63 24-hr. ALL MODELS OF cars wanted243 words
-
Advertisement397 1996-06-15 33 382 Vehicles For Hire A DATSUN PICKUP $25/ Lorry 14 ft./ van at 586 Geyiang Rd. Junction 34. *****37/ *****14. BLUE STAR CAR Rental offers 1000-2000 c.c. cars for hire at very good rates. *****43/ *****61. CALL- SETO MOTOR for pickup, blind van box van for hire. (Golden Mile Twr.)397 words
-
Advertisement1042 1996-06-15 33 383 Vahictos Wantad CUSTOMER FIRST. '79 '89 COE/ without COE. 7 reasons why you must sell your car to us. Buy at your price/ at your convenience/ pay extra cash on the spot/ free lift home/ free valuation/ no buying gimmicks! *****75 24 hrs. ATTN. ALL CAR owners, we pay1,042 words
-
-
Page 34 Advertisements
-
Advertisement925 1996-06-15 34 391 Vans For Sale LOT H OEFU USED CAR CTR. 180 AIRPORT ROAD Buy Sell Commercial Vana, Pickups, Lorrlea, 10' to 28' Tippora, and PB Buses TIL: *****72/ 3 (Mr Ongl '98 Nissan CMB7 20ft. lorry '93 Isuzu NPRSB 14ft. lorry '93 Fuso 20 ft. wooden body '92 Mitsubishi 14925 words
-
Advertisement985 1996-06-15 34 392 Other Commercial 392 Other Commercial 392 Other Commerciel Vehicles For Sale Vehicles For Sale Vehicles For Sale ..ii iiV^l B HBa^\ THE NEW VOLKSWAGEN TRANSPORTER. A SMART INVESTMENT FOR YOUR BUSINESS. COMPREHENSIVE SAFETY FEATURES Protects you like no other von DRIVES LIKE A CAR Works harder than any other985 words
-
Advertisement708 1996-06-15 34 393 Motorcycles/ Scooters For Sale SUPER 4 VR $2800 STEED 400 '96 modal $2800 Bandit 400 $1950 Vulcan Classic 400 $3500 CBR 400 RR 1500 PGM 1260 ....$lOOO LC 125 ....$5OO Honey 125. .***** KTM 125. .***** TZR 125 ....$BOO YPVS 125. ...5700 SR 125 Chopper $1200 We do trade-in708 words
-
Advertisement895 1996-06-15 34 393 Motorcycles/ Scooters For Sale INTRUDER 1400/ SUZUKI. Mod el '93. Regd. '94. No tax. Good cond.! Mileage 16,000. $11,700. Tel. *****55/ *****32 1989 EN 400 Chopper on sales. With Monokey box. Stable relaxing. Asking for $2600. Please page Mark at 9210-2951. 2/'94 STEED 400. $14K; 8/'95 Harley Softtail special.895 words
-
Advertisement875 1996-06-15 34 393 Motorcycles/ Scooters For Sale HONDA CBR 400, Suzuki GSXRP, SDR. View: 18 (inside Lor. 13) Geylang Rd. Tel: 747-3040 HONDA VF7BO SABRE. COE 2002. Unique well maintained. Pg. *****482 Mr Ng. HONDA 1984 CB7BOF. Meticulously maintained. New parts. Beautiful cond. $3600. *****76 KAWASAKI GPZ 400. Selling $1500 neg. Good875 words
-
Advertisement771 1996-06-15 34 402 DOl-08 City South-Wast PTE APTS Rant D.04 HARBOUR VIEW TOWER. 1615 sq.ft. 3+l rm. 4 bath. F/furn. $5.6K. Vic *****28/ *****130 MR D.04 MT. FABER Lodge Penthouse. 4+l. 3 levels. F/aircon. Facilities. Near city. *****223 Aim D.04 SABER LODGE condo. 3,700 sq.ft. 4 bdrms. Near city, $7500. Pg: *****436.771 words
-
Advertisement1271 1996-06-15 34 404 DO9-10 Orchard/ 404 DO9-10 Orchard/ Tanglin/ Holland Tanglin/ Holland PTE APTS Rant j PTE APTS Rant i j IMMEDIATE OCCUPATION At the junction of Scotts/Orchard Road next to Hyatt Hotel 14,000 sq ft Luxurious Hotel Style Lobby Swimming Pools, Tennis Courts, Billiard Rm, Squash Court, Gymnasium, etc. Self-Service Free1,271 words
-
-
Page 35 Advertisements
-
Advertisement876 1996-06-15 35 404 DO9-10 Orchard/ Tanglin/ Holland PTE APTS Rent 0.09 EURO ASIA Ct. 3 rms. 1700 iq.ft. F/aircon./ f/furn. Mid fir. Facilities. Amenities. *****025 APN D.09 FUTURA APT. 2800 sq.ft. 4+l, High fir. Pte. lift. Near Orfhard/MRT. Sole agt. CJ *****512 0.09 FUTURA. 2800 sq.ft. 4+l. 49th fir. Pool/ tennis/ pte.876 words
-
Advertisement724 1996-06-15 35 404 DO9- 10 Orchard/ Tanglin/ Holland PTE APTS Rent D.lO LEEDON HGTS. 3+l. 1650 sq.ft. $4,500. Ground fir. F/ furn. Full facilities. Hang Fatt 225 5588 D.lO LEWIS ROAD OFF Bukit Timah walk-up Flat. $2,800 furnished. Pg. 9315 2793 D.lO MARBELLA CT. Resort living. 1700 sq.ft. 3+l. Squash, f/furn. $4500.724 words
-
Advertisement575 1996-06-15 35 406 Dll ft 21 Newton/ Bt Timah/ Clementi PTE APTS Rent HJ HGTS. BEAUTIFUL mais. Full facility view. Approx. 2800 sq.ft. 3+l+l+l. Marble/ parquet. F/furn. F/aircon. Huge balcony. Back gdn. $6K. Owner pg. *****478. BUKIT TIMAH/ SIXTH Ave. 3 rms. Renovated. Aircon. P/ F/furn. Amenities. Immed. $3,200. Pg: *****780 owner.575 words
-
Advertisement713 1996-06-15 35 406 Oil A2l Newton/ Bt Timah/ Clementi PTE APTS Rent D.21 CHESTNUT VILLE 2200 sq.ft. 3+l+patio. Tastefully renovated $4800 neg. *****298 C&H D.21 CLEMENTI PK. 1650 sq.ft. Well furn. Full facilities. 3+l. Low fir. $4500 neg. 9-*****99 Villa. D.21 CLEMENTI PARK/ Pandan Valley. 2 rms./ 3 rms. Furn. $3000/ $4300.713 words
-
Advertisement669 1996-06-15 35 408 Dl2-14 Balestier/ Macpherson/Geylanj PTE APTS Rent D.14 ONLY $2200 neg. Guili Mans. 1100 sq.ft. 3 rms. F/aircon furn. Near MRT. *****575 agt. D.14 PALM LODGE. 4 bdrmi 1650 sq.ft. MRT. Aircon. Furn. curity. $2700 neg. YK *****182 D.14 WINDY HOTS. Near MRI Beautiful renovation. Low fir. Qu et breezy.669 words
-
Advertisement1970 1996-06-15 35 410 015-16 East Coast 410 Dl 6-18 East Coast 410 Dl 5-16 East Coast i 410 Dl 5-16 East Coast j PTE APTS Rent PTE APTS Rent PTE APTS Rent PTE APTS Rent a Imansions^-" 1 i usurious apartments 1 jTfl I B Ix)cated at Lorong KTelok Kurau i lltfl1,970 words
-
Advertisement536 1996-06-15 35 412 Dl7-18 Changi/ Pasir Ris PTE APTS Rent OPEN HSE. 1-3PM. Melville Pk. 3 rms. Pool view. Furn./ unfurn. Rent neg. Pal *****38/ 9-*****51. POOL VIEW PASIR Ris Gdn. 1600 sq.ft. 3 bdrms. Near TPE, f/ furn. $2600 neg. Pg. *****256 $2,600/ $3,000/ $3,800 Melville Pk. 2 bdrms./ 3+l bdrms.536 words
-
Advertisement714 1996-06-15 35 416 022-28 Wett/ North PTE APTS R—t GRANDE VISTA. 3-BDRM. Facing pool. 1367 sq.ft. Avail, immed. Co-broke welcome. Pg. 9-*****09 SH Gary. CASHEW PARK CONDO. 1.367 sq.ft. 3+l. Well renovated. F/furn. $2700 neg. Esther 9808-1921 ERA CONDO. MAIS. 4 RMS. 2600 sq.ft. Gdn. Car porch, p/furn. Facilities, immed. $3300. *****131714 words
-
-
Page 36 Advertisements
-
Advertisement730 1996-06-15 36 416 D22-28 West/ North 416 D22-28 Wett/ North 416 D22-28 Watt/ North PTE APTS- Rent PTE APTB Rent PTE APTB Rent 1 1/^Ti^Sm ill A s I fxV* jj^^ Luxurious Condominium fIjgCUPATIQN Located at the junction of Yio Chu Kang Road CTE to Orchard Road Schools, supermarkets, shopping centres wide730 words
-
Advertisement476 1996-06-15 36 420 Houses For Rent D.ll GENTLE VILLA semi-d s+l. Fully aircon. Beautiful interi or. Good facing. Near MRT. Avail soon. CHL *****40 D.12 CHANDER RD. Near town 1600 sq.ft. 3-rms. Near amenities Immed. For foreign workers $2500 neg. La-Choice *****103 D.I B BEAUTIFUL. BRAND nev 3 storey semi-d. Facing park.476 words
-
Advertisement794 1996-06-15 36 420 Houses For Rent D.lO MT. SINAI location. Renovated semi-d. 6+l bdrms. $8000. 9804-7501 CH D.lO NEW 2%-STOREY semi-d. 6 bdrms. 4000+ sq.ft. F/ aircon., unfurn. 9-*****06/ 9-*****32 agt. D.lO ONE TREE Hill d/storey semi-d. 3+l. 5000/ 3000 sq.ft. Long driveway. HH *****79/ *****529. D.IO ROCHALIE DR.. Camden Pk. Leedon794 words
-
Advertisement987 1996-06-15 36 420 Houses For Rant EXPAT. LOOKING FOR accommodation. Please call: *****87/ pg: 9-*****99 Agent. FABER HILLS 2-STOREY semi-d. 4500 sq.ft. Well kept. 4+l bdrms. Furn. $5000. Michael Y *****66. QEYLANO, 2-STOREY RESTORED shophse. Avail. 8/'96. Suit assn. Ray *****063 Huens MEYER RD. Tastefully renovated. Spacious d/storey detached. s+l. $BK. Connection:987 words
-
Advertisement1005 1996-06-15 36 422 HUDC/ HDB Apta For Rent APPROVED 3-RM. YISHUN 742 MRT. Furn. 2 split aircons. $150 neg. Immed. 288-3892 ARN. APPROVED 3-RM. TAMPINES Übi Avenue. Furn. Aircon. Immec $1300 neg. Pg. 9804-5394 agt. APPROVED 1-RM. 1 hall Kalian. MRT. Unfurn. Min. 2 years least Pg. 9404-8312 Data. APPROVED 4 'A'1,005 words
-
Advertisement886 1996-06-15 36 i 422 HUDC/ HDB Apts For Rent a 37 8-RM. JURONG. 4-rm. Bedok/ 0 Tampines. 2-rm. Kallang/ A.M. Kio. L-shaped Whampoa. Pg. *****851. V 3%-RM ANO MO Kio. F/furn. Air- cons. MRT. Windy. High fir. Rental $1300. Interested call 9-*****54 g 3-RM APPROVED POTONG Pa- sir. Above shop. Aircon. Unfurn.886 words
-
Advertisement756 1996-06-15 36 426 Rooms For Rent ATTN: HK/ INDIAN expat., students ft singles. Call for your choice of master/ common rm. in any area. Janice *****220 C&H. AVAIL. RMS. IN Queenstown, Redhill, Tiong Bahru, Bt. Merah, Telok Blangah, Holland, Dover Rd., Clementi *****03/ Pg. *****642 D.09 CAVENAGH GDNS. Expat, room mate to756 words
-
Advertisement846 1996-06-15 36 420 Rooms For Rant COMMON RM. AVAIL at Bedok, Hougang, Ang Mo Kio for rental. Pg. 9209-4244. COMMON RMS. SERANGOON N. Ave. 4. Aircon. F/furn. Cooking/ heater. MPC 9216-8128/ 291-2828. COSY FURN. AIRCON. rm. for rent at Pasir Ris St. 21. Single lady/ couples. Tan: 9-*****66 agent. COUPLES/ LADIES/ STUDENTS846 words
-
Advertisement1274 1996-06-15 36 426 Rooms For Rant ROOM AVAILABLE FOR rent in Potong Pasir. No agts. pis. Contact Pg. 9411 8491. ROOM AVAILABLE FOR rent at Bishan Street 22. Please Pg. 921-927-95. ROOM FOR RENT in Tampines. Prefer expats. Immed. Near MRT/ amenities. Pg. 9204-0928 ERA. ROOMS AT WOODLANDS/ Pasir Ris. Single/ couple.1,274 words
-
-
Page 37 Advertisements
-
Advertisement757 1996-06-15 37 441 DOl-08 City South- West PTE APTS -Sale D.04 HARBOURUGHTS 1 Hilltop apt. facing Sentosa •807/1163/ 1249 sq.ft. Near to future MRT retail sit Ui Fantastic future investment $980 p.s.f. $1260 p.s.f. neg. Sola Agent COLLIERS JARDINE Pa. 9-*****37 Mark No >ejtß. pie. D.07 BETTER INVESTMENT OPPORTUNITY. Min Yuan. High757 words
-
Advertisement1304 1996-06-15 37 445 009-10 Orchard/ 445 DO9-10 Orchard/ 445 DO9-10 Orchard/ Tanglin/ Holland Tanglin/ Holland Tanglin/ Holland HOUSES -Sale HOUSES Sale HOUSES Sale 3 storey detached Erungafow V'iewed as the most < '^ESfiT^ikm sought-after district, imss^P^^ .JRP' W S B just minutes away from prime I IRpVBB|BsI schools like Hwa Chong Junior1,304 words
-
Advertisement1250 1996-06-15 37 446 DO9-10 Orchard/ 446 DO9-10 Orchard/ TangliiV Holland Tanglin/ Holland PTE APTS Sala PTE APTS Sale =s s==s Apply tprahomelqan %M& g highly attractive interest ||ej|cj||. Sail our Carjpie on 1800-322-4567, But hurry, this offer ends 30 June "96. msr(imi^ftiUms ymtimiioithtptmotion DUCHESS CREST. 3 rms. 1378 D.09 ORANGE HOTS. 30001,250 words
-
Advertisement615 1996-06-15 37 450 Dll &21 Nawton/ Bt Timah/ Clamanti HOUSES Sala mlmmmmmmmmm^m^mmmmmmmmmmammmmmm D.ll NO. 18 LORNIE WALK OPEN HOUSE: 2PM BPM. Beautiful 2-storey Semi-d. 2 yean old in showhouse condition. 325C sq.ft./ 2650 sq.ft. F'hold. 4+l bdrms. Sell at valuation. $2.7M D.ll JALAN UNOGAS Prime exclusive location 2-sto rey Semi-d. 3800 sq.ft.615 words
-
Advertisement568 1996-06-15 37 450 Dll A2l Newton/ i Bt Timah/ Clementi HOUSES Sale D.21 CHENG SOON Gdn. 2tt storey inter./ corner terr. 3/ 4+l F'hold. $1.6M up. *****563 LP. D.21 HUA OUAN Ave. 2 storey Inter. Terr. 3-bdrms./ servant's Split level living/ dining. 481-2747 I D.21 SUNSET O/storey bunglw 6600/ 4000 sq.ft. s+l.568 words
-
Advertisement1192 1996-06-15 37 451 Dll &21 Newton/ 451 Dl l ft 21 Newton/ I Bt Timah/ dementi Bt Timah/ Clementi PTE APTS Sale PTE APTS Sale ==============555=; Apply for a home loan at this highly attractive interest rate today. Call our Careline on 1800-322-4567. But hurry, this offer ends 30 Jurie xi&to huaijKttoUmi1,192 words
-
-
Page 38 Advertisements
-
Advertisement1084 1996-06-15 38 4M Dl2-U BaicttMr/ 456 Dl2-14 Bale. tier/ 456 Dl2-14 Bale.tier/ 456 DIM4 Baleitier/ 456 DT2-14 Balattiar/ MrariMraen/Qeylang Macpharion/ Geylang Macphanon/ Geylang Macpherson/ Geylang Macpherion/ Geylang PTE APTS Sala PTEAPTS Sala PTE APTS Sale PTE APTS Sala PTE APTS Sato you should J consider V I vsnnn "Wif jj "^""v i1,084 words
-
Advertisement288 1996-06-15 38 460 D l5-16 East Coatt HOUSES Sato D.16 SEMI-D 75 UMAU GARDEN OPEN HOUSE 10AM-6PM. Land 4841 sq.ft. Built-in 3600 sq.ft. Fully aircon., 4 rooms 3 halls. Beautiful Garden view and big fish pond. Alarm, auto-door. Electricity supply at 400 watts. Facing south-west with no setting sun. Can rebuild to288 words
-
Advertisement728 1996-06-15 38 460 DIH6 East Coast 460 015-16 East Coast HOUSES Sal* HOUSES Sala At No. 381 KEW CRESCENT Brand New Luxurious 3-storey Semi-Detached and Corner Terrace TOP issued 6-1-1 bedrooms Land: 3060 to 4660 sq. ft. Built-in: 3305 to 4467 sq. ft. F <SbWW*EPTELTD (A Subsidiary of Orchard Parade Holdings Ltd)728 words
-
Advertisement648 1996-06-15 38 D.16 BUNGLW. URGENT sale! Brand new 5400/ 5504 sq.ft. (2 units) 3-storey. 6+l rms. TOP '97. $3.4M/ $3.98M. Gateway *****437 D.16 KEW DR. 3 storey semi-d. F'hold. 3300/ 2750 sq.ft. 3 bdrms. (potential for 5-bdrm.) Large gdn. $1.98M. Ong 9315-5735 ERA. D.16 KEW CRESC. inter, terr. Spacious 1700/ 3200 sq.ft.648 words
-
Advertisement758 1996-06-15 38 460 Dl5-16 East Coast HOUSES Sale D.16 UPPER CHANGI Rd. East. S/storey, semi-d, 3682 sq.ft. 3-rms. Good Price. *****648 ERA D.16 1 PAIR/ 1 Semi-d. Wide frontage. F'hold. 5 yeers. 4 rms. $2M each. Transworld 9404-5645 D.16 2/STOREY SEMI-D, 4850 sq.ft. beautifully renovated. Autogate. S2.BM neg. Trivest *****948. D.16 2-STOREY758 words
-
Advertisement884 1996-06-15 38 461 DlB-16 East Coast 461 015-16 East Coast PTE APTS Sala j PTE APTS Salt Apply for a home loan at this HHELIHS9H9B D.lB THE WATERSIDE 2411 i sq.ft. 4+l bdrms. Unobstructed view. Viewing strictly 3pm. todayl Harvest *****88/ pg. 9-*****87 D.lB THE WATERSIDE. 2411 sq.ft. 4+l bdrms. F'hold. Good884 words
-
Advertisement861 1996-06-15 38 D.IB 1894 SQ.FT. 4+3 Split din! ing/ living. Pool view. Near amenit ties. 51.32M neg. AP *****123 D.16 BAYSHORE PK. 2351 sq.f High fir. 4 bdrms. Tenanted ti 7/57. Wendell 9303-7871 RN. D.16 BEDOK CT. 1888 sq.ft. 3 rm. Full condo. MRT. Selling valuation. AP 9411-7138 Sole agt D.16 BEDOK861 words
-
-
Page 39 Advertisements
-
Advertisement642 1996-06-15 39 461 015-16 East Coast 461 D l5- 16 East Coast 461 D l5- 16 East Coast PTE APTS Sale PTE APTS Sale PTE APTS Sale jT 8 1 DOMAIN CENTRE (914 East Coast Road-Opposite Siglap Centre) Brand New Apartments FOR SALE Immediate Occupation (Developer absorbs 3% •tamp dut Y) w642 words
-
Advertisement483 1996-06-15 39 470 Dl9-20 Serangoon/ Thomson HOUSES Sale 5 mmmmmmmmmmmmmmm^mmmmmmmammmammmmm 3+l roon Hi Fully Fit PATRICIA NG (U8) New Toj j^!^,!™ Facdfft 1 1 SlSifiKKfici^?!! Near Arr [BTliglrMCtTEl Clean Qi JOO HONG ROAD r Singapore 1984 1 Open house 3-4.30pm I New d/storey terrace 1650/ 1900 sq.ft. Freehold 3+l rooms Asking $1.28M483 words
-
Advertisement557 1996-06-15 39 470 Dl9-20 Serangoon/ Thomson HOUSES Sato OUR CHANCE TO GET A HOLD 2-STOREY TERRACE FOR ONLY $732psf v Lian Park X) sq.ft. ns outh East ted European Kitchen lets olished Marble/Parquet Floor Move-in-Condition lenities iiet Pleasant Environment D.19 SERANGOON GDN. Renovated semi-d. 3+l bdrms. Spacious 2800/ 2000 sq.ft. Face mom.557 words
-
Advertisement2240 1996-06-15 39 465 Dl7-18 Changi/ 469 D l7-1 8 Changi/ 465 Dl7-18 Changi/ 465 Dl7-18 Changi/ 465 D l7-1 8 Changi/ 465 Dl 7-1 8 Changi/ Patir Ris Pasirßis Pasirßis Pasirßis Pasirßis Pasirßis HOUSES -Sale HOUSES Sale HOUSES Sale HOUSES Sale HOUSES Sale HOUSES Sale The Straits Times Classified PROPERTY GUIDE (PRIVATE2,240 words
-
Advertisement615 1996-06-15 39 ft Ma— i^— ala— a— —l 475 D22-28 West North HOUSES-Sale D.26 LENTOR. FREEHOLD D/storey corner. 3300 sq.ft. Mov I in. Near MRT/ good school I Thoughtfully renovated. See ti I appreciate. Pg. 9-*****39 ERA. I JLN. MALU-MALU S/STORE' semi-d. 3513 sq.ft. Well renovatec 1 51.62M. Cheap. Meng Suan Roa615 words
-
Advertisement853 1996-06-15 39 475 D22-28We«t A North HOUSES Sale s D.28 JLN. KELULUT s/storey semi-d. 3500/ 2000 sq.ft. 3 bdrms. Can rebuilt. $1.68M. 9510-7834 D.28 ULAC DR. Exclusive corner terr. Land 5472/ 2874 sq.ft. S.E. Don't missl $2.SM. EH *****879 D.28 MUST SELL! D/storey Terrace. 3+l. 2400/ 2000 sq.ft. Springleaf: 9306-2807 Lee Ching.853 words
-
-
Page 40 Advertisements
-
Advertisement793 1996-06-15 40 479 Mixed Districts HOUSES Sale jBt.II Sunset Way bungalow 0.17 Toh Close bunghw D.lB Jin. Limau Purut aami-d D.17 Jin. Batalong semi-d D.17 Jin. Ketompong sami-d D.16 Mara Terrace terr. D.lB Kaw Gate terrace D.14 Lor. Marican tan. O 20 Jin. Chempedak terr. 0.20 Jin. Chengam terr. GRANDHOME fNT'L PTE.793 words
-
Advertisement1139 1996-06-15 40 492 HDB Apts For Sala (Ang Mo Kio) ERA SHOWHOUSE TODAY 2 -spm. Blk. 111 #08-58 Ang Mo Kio Ave. 4 Comer 8 'I' Beautifully renovated Expensive kitchen cabinet/ cornices I Door to door facing Contact David Huin Pg. 9-*****38 s A.M. KIO PT Blk. 539. 5-rm. #16. I Marble1,139 words
-
Advertisement861 1996-06-15 40 492 HDB Apts For Sala (Ang Mo Kio) 3V. RM. A.M. KIO Blk 476, mio fir. Unblock. Quiet. Best facing broken marble. *****732 Malpore 3-RM. ANO MO Kio Blk. 156/ 502 4-rm. Blk. 440. Renovated. Amenities. Price neg. Pg. *****166 YSP 3-RM. ANO MO Kio Blk. 558 Near MRT/ Mkt./861 words
-
Advertisement3723 1996-06-15 40 493 HDB Apts For Sale 493 HDB Apts For Sala 493 HDB Apts For Sala 493 HDB Apts For Sala 493 HDB Apts For Sale 493 HDB Apts For Sal. (Badok/ Chai Chaa) (Bedok/ Chai Chee) (Bedok/ Chai Chee) (Badok/ Chal Chaa) (Badok/ Chai Chee) (Badok/ Chal Chai 1 s*^Baa^B^B^B^B^B^Ba«BalBBBBBBBBBBBn*BBBBBa«a3,723 words
-
Advertisement908 1996-06-15 40 i 494 HDB Apts For Sak (Bishan) i ssaa BLK 261 EXEC mais. High fli Nobel Design. Open hse on Sur 2-4pm. Appt. only. *****677 agt. BLK. 262 4 'A' Bishan. 1001 move-in. 5 yrs. reasonable price Pg. *****170 Kryan CAN CONTRA! EXEC. Mais. Bis han Blk. 245. F/renovated/ wind\908 words
-
Advertisement983 1996-06-15 40 6 494 HDB Aptf For Sale i) (Bishan) s i 4A PT. BLK. 252 High fir. Renovated Good layout Price neg. Paul Young *****046/ *****77 HY. 6460K ONLY! 4 A' Bishan cer ner blk. 113. High fir. Contra. Cobroke. All races. *****464 UFI S *A" BISHAN blk. 221. High fir.983 words
-
-
Page 41 Advertisements
-
Advertisement989 1996-06-15 41 496 HDB Apts For Sale (Buktt Batok) ALL 4-RM. 171, high fir. panoramic view, move-in. 230, 232, MRT. shops. 9-*****28 GRN. K. 122 MAW. Near MRT/ bus Interchange all high demands amenities. Scanves 9-*****74 ..BLK. 231 3 'NG' Bt. Batok. 5 ipins. to MRT. Split aircon. Valued $146K. Pg. 9303-6021989 words
-
Advertisement1125 1996-06-15 41 497 HDB Apts For Sale (Bt Merah/ Q'town/ Telok Biangah) 3 RM. CORNER. Telok Biangah Cresc. Blk. 12. High fir. $245K neg. Can contra. Mkt./ food ctr./ Post Office CC. 9-*****32. Agt. Choo. AFFORDABLE C'WEALTH. DR. 3-rm. Renovated, mid fir. MRT/ mkt. Valued. Neg. 9311-3770 HSR. BLK. 89 T. Biangah1,125 words
-
Advertisement877 1996-06-15 41 499 HDB Apts For Sale (Central/City) 3 "I* BEACH Rd. blk. 3. 100% move in. Upgrading soon. Mkt. sch., MRT. Pg. *****535 C&H 3 'NO' EVERTON Park Blk. 6 High floor, unblock. MRT. Car contra. Please pg. *****101 AR 3 "NG' ROCHOR CTR. Blk. I Shops, MRT, $250K neg. Can877 words
-
Advertisement1031 1996-06-15 41 800 HDB Apts For Sale (Choa Chu Kang/ i Bukit Panjang) CAN CONTRA. 4 'A' CCK. Blk 286, nicely renovated. Mins. tc MRT, mkt., shop. *****747 GCPC. 1 CCK BLK 204 Exec. apt. 2nd. fir Expensively renovated. MRT/ ame nities. Co-broke 9-*****68 ERA. CCK. EXEC. MAIS. Unblocked Amenities. Well kept.1,031 words
-
Advertisement1040 1996-06-15 41 501 HDB Apts For Sale (Clementi/ West Coast) HfaNfffrS i Km* *"*g RARELY AVAIL! 4 'NG' Clemen- ti W. Blk. 711. Mkt./ Ginza/ sch. Renovated, high fir., all races, valued. Sole agent. *****163 Mary. TODAY OPEN HSE. (15/6) 7pm. to 9pm. 3 "NG' West Coast Blk 701. High fir. All1,040 words
-
Advertisement1041 1996-06-15 41 501 HDB Apts For Sal (Clementi/ West Coast) 4 'NO' CORNER Blk. 381 Cleme ti Ave. 5, low fir. Move in con Can contra. *****646 Propex. 4 'NO' DOVER Cresc. Blk. 5. We kept. Lots of greenery. Amenitie $355K neg. Transworld 9315-462 4-RM. BLK. 316 Clementi Ave. mid. fir., renovated,1,041 words
-
Advertisement835 1996-06-15 41 e 502 HDB Apts For Sale (Geylang/Eunos/ Macpherson) m- 4 'NO' PAYA Lebar Way. High id. fir. Unblock. MRT/ amenities. Pg. *****299 Simon, Villa ell 4 'NO' PAYA Lebar Way Blk. is. 121, high fir. Well renovated. !6. Open view. Kwan *****256 ERA 4, 4 "S" ÜBI, tip top cond.835 words
-
Advertisement1151 1996-06-15 41 504 HDB Apts For Sale (Hougang/ Serangoon/ i Yio Chu Kang) i Maß>iH^ iH^ M^ >i>>B^ Hi^ 4 'A' SERANGOON Blk. 425. Low fir. Balcony. Broken marble. Good sch. Future MRT. Can contra. 1 S42OK neg. *****134 Kojin Realty. S-RM. SERANGOON North Ave > 1, well kept with split aircon.1,151 words
-
Advertisement1035 1996-06-15 41 504 HDB Apts For Salt (Hougang/ Serangoon/ Yio Chu Kang) 4 'A' HOUGANG blk. 361, rej 10/'96. Can contra. Renovatec Near central. *****762 Jane, ER/ 4 "A' HOUGANG Central. Nicel renovated. Well maintained. MRI No agents. 9314-3989 CW 4 "A* LOR. Ah Soo. High fli Move-in cond. Near amenities View1,035 words
-
Advertisement1209 1996-06-15 41 I 505 HDB Apts For Sale (Jurong) AVE.B JURONG W. 4 A' Hiah fir. Move-in cond. Just 5 yw Good location. Near amenities I- Don't miss! Multiplex *****567 < EXEC. MAIS. BLK. 548 Juroljg W. Unblocked. F/renovated. Face y N.-S. MRT/ mkt. Can contra. LdW cash. No co-broke. 9803-5696 agl1,209 words
-
-
Page 42 Advertisements
-
Advertisement1031 1996-06-15 42 505 HDB Apts For Sale (Jurong) 4 'AY EXEC. mais. Jurong W blk. 330/ 317/ 440/ 558. High fir Renovated. *****841 agt. 4 "A' HIGH fir. Jurong West Bright. Can contra wait. Valued Grandhome *****750/ *****409 4 'A' JURONG W. Blk. 812. Higr fir. Rockstone/ cornices. Price neg No contra.1,031 words
-
Advertisement1003 1996-06-15 42 > 510 HDB Apts For Sale (Marina Parade) Ix OPEN H'SE SUN. 4 T Marine Crescent. Blk 34. 1-4pm. Unblock windy. Renovated. Schools k amenities. 9302-7113 DW 8-RM. PT. BLK. 3. High fir. with recess area. Sea/ city view. Nicely renovated. Marble. Bright 1 breezy. Valued $532K. *****159 ATTN.: FULL1,003 words
-
Advertisement725 1996-06-15 42 512 HDB Apts For Sale (Pasir Ris/ Changi] HURRYI CALL FOR appt. 5 T Pa sir Ris Blk. 446. High fir. Nea MacDonald, sch., MRT. 9311-6669 JUST 8 YEARS. 4 "A" Pasir Rh Blk. 486. Nicely renovated. Cai contra. Pg: 9-*****03 agt. LOW CASH 4 "A* Pasir Ris. Bl! 484.725 words
-
Advertisement1243 1996-06-15 42 514 HDB Apts For Sale 514 HDB Apts For Sale I (Tampines/ Simei) (Tampines/ Simei) 555=SS=S==^S£=: a^^^m proven I jmSt^mW TRACK RECORDS |I^s^/ JjP bait moved bundivds of families happily < '1 aw and smoothly. Why settle for less when you jkjho£Um could get the BEST Action speaks louder than1,243 words
-
Advertisement1196 1996-06-15 42 514 HDB Apts For Sale (Tampines/ Simei) EXEC. APT. TAMPINES Blk. 148 High fir. Low cash. No blocking. Opp. MRT. Elaine *****778 ERA EXEC. MAIS. TAMPINES Blk. 858, high fir. Unblocked, well renovated. Chua *****509, ERA EXEC. MAIS. TAMPINES. High fir. Facing pk. Windy. MRT/ amenities. View to offer *****6551,196 words
-
Advertisement1009 1996-06-15 42 514 HDB Apts For Sale (Tampines/ Simei) 4 "A* TAMPINES blk. 261. High floor. MRT. Market. School. Cobroke. Pg. 9516-6249, no contra. 4 "A" TAMPINES Blk. 263. Near MRT/ amenities. Bright windy. Can contra. Pg: 9-*****03 agt. 4 'A' TAMPINES blk. 286, corner, high fir. No blockage. Best facing. Windy.1,009 words
-
Advertisement1232 1996-06-15 42 516 HDB Apts For Sal< (Toa Payoh/ Potong Pasir) BUY NOWI 4 'I' T. Payoh Lor. I high fir. Renovated. Cash $451 Don't wait! Supra *****706 HMF CASH $66K. ABOVE valuatioi 4-rm. T. Payoh. Act fast. High fl Good location. B&A *****796 CORNER EXEC. MAIS. Kim Kea high fir. Marble,1,232 words
-
Advertisement1019 1996-06-15 42 8 517 HDB Apts For Sale (Woodlands/ Sembawang) S, JUMBO FLAT WOODLANDS St 31 Blk. 303. Near MRT, shops. Al races. P. Advisory pg. 9707-5131 i. NEW LISTING. 4 'NG' Blk. 201 C r. units)/ 7-rm. Blk. 304/ 5-rm. Blk 173. Price neg. Pg. 9409-5286 TL t, RAREI WOODLANDS JUMBO1,019 words
-
Advertisement731 1996-06-15 42 > 918 HDB Apts For Sala (Yishun) OPEN HSE. 6-7PM. 3 NG' Yis I hun Blk. 739. #05. 3 mins. to MRJ/j amenities. Valuation SIS3K. RafltT" I vated. 9-*****66/ *****91 CRE^g OPEN HSE. 2-4PM. 5 T Yishun Blk. 289. Beautifully renovatedv Move-in cond. Low fir. View to offer. Don't miss!731 words
-
-
Page 43 Advertisements
-
Advertisement2148 1996-06-15 43 518 HDB Aptt For Sale 518 HDB Aptt For Sale (Yishun) (Yishun) f aW I We Don't Sea", Wei Pay 1 -fLttSs&a PJ« Monthly Lucky Draw ",f SI RESALE •OftVouchers ■H aV CHAMPION r Commitment Guarantee WW ll* HDB Valuation Report Home Coverage Plan i^B jjsg»a> f Ho"* Moving Plan2,148 words
-
Advertisement806 1996-06-15 43 520 HDB Apts For Sale (MixedjOthor Estates) s (Lie. no: AJDO4I-S62BA) 3A Blk 2so Tampines Mins to MRT/ Renovated/ Mid-floor 3A Blk 274 Tampines Renovated/ Mid-floor /amenities •4S Blk 174 Yishun Original condition/ Well-kept/ High-floor 4 NGBlk 148 Yishun Original condition/ Well-kept/ qpen-space/mins walk to Central and MRT 4 NGBlk806 words
-
Advertisement650 1996-06-15 43 526 Private Apts Wanted (Rent/ Buy WANTED PROPERTIES FOI Buyers/ Tenants with good bud gets. Owners pis, call 469-2194 627 HUDC/HDB Apts Wanted (Rent/ Buy I PROPEX PROPERTY EXCHANGE Pleaa* call me> ABOUT HIGHEST POSSIBLE SELLING PRICE FOR YOUR FLAT WITHIN THE SHORTEST POSSIBLE TIME Please Try Mel Have managed650 words
-
Advertisement945 1996-06-15 43 527 HUOC/HDB Apts Wanted (Rent/ Buy) k URGENT!!! ANY LOCATION!!! 4/ 5-rm./ Exec. Mais. Apt. by ready buyers. Good budget. Call *****05 for our certified agents. CASH ADVANCEMENT, ar rangeable up to $20K. We have ready buyers. Call 221-3835 ALL AREAS WANTED. Hong Kong agt. with ready PR buyers, sell/945 words
-
Advertisement799 1996-06-15 43 532 Factory Space 532 Factory Space For Sale For Sale BUSINESS FOR SALE A Company, in the business of manufacturing processed food mainly for exports, is available for sale. The company possesses a fully fitted licensed food factory and office building situated in Woodlands East. The food factory and the799 words
-
Advertisement664 1996-06-15 43 534 Office Space For Rent D.02 DUXTON RD. conservation office for rent, approx. 3000 sq.ft. 3 storey, near MRT, *****952 SH D.03 LENG KEE Rd. 5000 sq.ft. Low rental. Aircon. Immed. Good location. *****835 agt. D.06 HIGH ST. Dr. Office space for rent. 2 units, 2000/ 2100 sq.ft. Partition. Price664 words
-
Advertisement1142 1996-06-15 43 535 Office Space i 535 Office Space For Sale For Sale 79 ROBINSON ROAD. #31-00CPF BUILDING, SINGAPORE 0108. TEL: *****88/221 9622. \QT OPEN SAT TIL 5.00PM. llHinP YOUR KEY TO EASY FINANCING 537 Shop Space 537 Shop Space For Rent For Rent Blk. 165. Facing bus terminal NTUC. Suitable for1,142 words
-
Advertisement583 1996-06-15 43 537 Shop Space For Rent WOODLANDS BLK. 111. 330 sq.ft. Shop with own toilet. Rental $2500. Pg. 9-*****39 Pang YISHUN RING RD7 Ave. 5. Near mktV food ctry 7-Eleven. For clinic/ retailing. Pg. 9513-8183 VP. BLK 481 TAMPINES for rent/ sale. Call *****15 after 11am 538 Shop Space For Sale583 words
-
-
Page 44 Advertisements
-
Advertisement1526 1996-06-15 44 940 anop apace i 538 Shop space For Sale For Sale I Sell© Ol* &<€£«&s€£ Fully restored for immed. occupancy Areas from 602 sq. ft. 2,906 sq. ft. Suitable for Retail Office all trades •Ample parking amenities •1 5 mins. walk to Bugis MRT JLN. BT. MERAH HDB d/storey shop.1,526 words
-
Advertisement542 1996-06-15 44 973 Air Tickets CHEAP AIRFARES S3B-031 Europe $930, UK $885, US $84 Sydney $610. Canada $1250, Pei $510, Jakarta $125, HK $510. F nang $240, Japan $690, Taip $580, Manila $430, China $4S Bali $320, India $730, KL $170. F MAS, SQ, CX, QF, etc. Misa TA9 ATTRACTIVE AIR TICKEI542 words
-
Advertisement739 1996-06-15 44 581 Tours sol Tours 581 Tours 981 lours i aoi lours 981 Tours 8. Of i I A A I Explore the beoufiful world of Mother Norure and hove rhe most fabulous rime of your life! !i MllD SU J0&IK immMmMM^ jr^ dDAYSBon 9 kok/Pottoyo/ $***** o 111 WM HI739 words
-
Advertisement273 1996-06-15 44 »8i lours 4/5 Medan/ .340 DEP: DAILY 4/5 £"wrta7 *369 i^Vn Bandung/Cipanas v > *^DtP:Junl« r 2O 4 Bali $499 DC P. DAILY- SOI INN L^^ v LLT|T|ILLI^ 4 EUROk\stA C£bmmLCmS i #02-11' P«a<* Centra i 440 Bad 5428 24 I 4 4/50 UtadanLatoTooa-iaw -*A ISO Jakarta Bandung-lMa 55 5*50273 words
-
-
Page 45 Advertisements
-
Advertisement914 1996-06-15 45 881 Tours 881 Tours 881 Tours 881 Tours 581 Tours j 581 Tours 581 Tours 581 Tours 581 Tours i 581 Tours Wmmmmmmmimmm^^^m—mm^^m wmm^u^ammimam^ammmmmmmmmmmm l ll^ i I f^lßl^^^MHk AMERICA JAPAN KOREAN F AUSTRALIA I W* ISt 1 50 CUStOmerS D miSSRm M4t^^ ANAM/ M oo Coast/Svdner A5 1 738914 words
-
Advertisement567 1996-06-15 45 |H J^MLr f~ JJfe Ug HHWHWKKHHK Joint Promotion With Singapore Airlines S «H -THIOf«.CArrDU.OfTHEWO«ID l|^_ ■*OBAIPI WTAWAT Stay or In* Desert |otp Every Friday/Sunday Cov* Underground Hotel ■fr _M^ I frhe wofWs firsf underaroond hotof)* KPHbII I _b W H H ■A!u jummmm $000 I 06 days ADELUPC/ JCOOiERPfDY J^L567 words
-
Advertisement156 1996-06-15 45 586 Travel Needs 586 Travel Needs 586 Travel Needs I <A* Valid Till 30/6/96 7"^& THE WINTER WEAR SPECIALIST ft- P"*' 1 «»»T at *>«*> Bridge Road Shopj 827 Religious Announcements FREE ADMISSION VENUE: 21 Adam Road Singapore *****2 Also Available: Chinese Services at 8.30am 11.00am Ministries for Children, Filipino,156 words
-
Advertisement108 1996-06-15 45 830 Other s Announcements/ Messages NURJANAH PP No: XA *****5 j The abovenamed maid has been missing since 9 May 1996. Anyone I who knows of her whereabouts, kindly contact: AK> Than Til: *****00 orOrdoh Tak *****33/ Pg: *****849 I A reward will Im given. I I > jfl fe108 words
-
-
OBITUARIES
-
Obituary, Illustration369 1996-06-15 46 850 Deaths 850 Deaths 850 Deaths 850 Deaths POH KIM LEONG AGE 72 passed away peacefully on 14 June 1996 leaving behind r^KOHBAHLEE SoiUf Daughters-in-law Poh Eng Huat Urn Guat Hua Poh Eng Soon Fpong Kow Mooi Poh Eng Teck Sim Choo Tee Poh Eing Chong Dorothy Bin Poh Eng369 words
-
Obituary, Illustration147 1996-06-15 46 852 Acknowledgements 852 Acknowledgements Hm Family of the Late SAW Zl 8IANG Departed 10 June 1996 wish to express their heartfelt gratitude and Or Ong Hian Tat from NUH H'se Doctors Nurses from NUH ward 45 ICU Singapore Soka Association Henderson Chapter Teachers Staffs from AWWA Specials School Relatives, friends147 words
-
Obituary, Illustration104 1996-06-15 46 In cv#riovfn{| Memory of sir. cnwira nafa Sundarant Ponniert No pen can write, nor tongue tell My sad and bitter loss But God above has helped so well To bear my heavy cross Fondly wwmbwwd by wife. Richway Ponnampalam We will always cherish the times we spent104 words
-
Obituary, Illustration66 1996-06-15 46 852 Acknowledgements 852 Acknowledgements 852 Acknowledgements THE FAMILY OF THE LATE MRS EDWARD CHIA nee PNG AH CHYE wishes to express their heartfelt thanks and appreciation to: Rev (Dr) John Urn of Calvary Baptist Church doctors and nurses of Neuroscience Ward 33 TTSH relatives (local ft overseas) friends, colleagues, neighbours66 words
-
Obituary, Illustration72 1996-06-15 46 856 In Memoriam 856 In Memoriam 856 In Memoriam In Memory of our beloved Father POH KIM LEONG Age 72 s<m,<: PohEngHuat PohEingChon Poh Eng Soon Poh Eng Toon Poh Eng Teck Poh Eng Walt Daughter: Serene Poh Soh Hong From: Management Staff of POH BROTHERS GOLF PTE LTD. IN72 words
-
Obituary, Illustration110 1996-06-15 46 2ND ANNIVERSARY JOO CHIAT DABB Departed 18th June '94 Not just today but avary day. We ramambar the times wa shared. Ahmya raaMMbwwl by JOO CHIAT BROTHERS Pg. 9308-3612 for prayer details kt Loving M— wry Of LTA. YAP SUMO TEMQ (SUNNY) Dap-tad: ißth Jmm 84 (USA)110 words
-
Obituary, Illustration118 1996-06-15 46 ATHMA SANTHI POOJA THANABAL S/O VEEftASAMY Dapartad on 3/W96 Kmuhmuii pmy%n will t>+ hold •t Blk S St George's Road #14-69 e« 18/6/96 at night. AtfMM Santhi Prayers will be hald at Sri Sivan Temple, 24 OayUma Eaat Ava 2 on 16/5/96 (Sunday) at 7.00pm. Please treat this118 words
-
-
Page 46 Advertisements
-
Advertisement1093 1996-06-15 46 I'ifrllwHHlßiwH nffil giBoo-757-1166 fQQIit Bummnm <w»wi««if &s*»> riRTAJNUfNT Property Financing /Insurance 432 ?»,y».'gSs**!LL..— .^J open Houses/ Show Unite 433 Bakeries Oetaatessens 5 t»1-0S City SouoVWest „<£.«. it Houses-Sale 440 S™jT™ r]] 001-08City&Soulh-West rood items 14 pi. «-j, c^k, jj < SBsaEsssr-s Jettaurants/FoodOuttels 23 OW-lOOicr^/Tarigfn/Holand Tate-Aways 30 PteApts-Sate 446 Video/ Games1,093 words
-
Advertisement152 1996-06-15 46 860 Funeral Directors/ 860 Funeral Directors/ Services Servic— I Compien servtcet for Christian, BwWftist. JmM^^&A&^M Taoist Hindu, etc milVlilV^^^ lir-teoU paffote PI^H awnH I i«d i»e k nkmii eml ali nws K'JI r£F I tmr i j«(ty lo^Md local asK«t» I B 'Photo «rtaro9frt«it ami fiowera service available E^S Furura*152 words
-
Advertisement10 1996-06-15 46 "In Memoriam" is for the loved ones whom you remember...10 words
-
-
Page 1 Advertisements
-
Advertisement842 1996-06-15 1 APPOINTMENTS/NOTICES WHEN IMAGINATION A| RpfflillTlON IN BEGINS. SGS-THOMSON Microelectronics unveils AMK 8 a new state-of-the-art ULSI wafer fab. SGS-THOMSON Microelectronics, the global semiconductor company is again strengthening its fully-integrated presence here in Singapore. We are setting up another wafer fabrication plant AMK 8. This Fab will produce 8" wafers of842 words
-
-
Page 2 Advertisements
-
Advertisement681 1996-06-15 2 TheStraitsTiines APPOINTMENTS/NOTICES fi Agilis Communication Technologies Agilis Communication Technologies is a premier RF system house specialising in the design, development and manufacture of high performance RF/microwave systems and sub-systems. The majority of our products are exported. We are situated at Jurong East and work on a 5-day week. We invite681 words
-
Advertisement283 1996-06-15 2 HEf~» EPB Publishers Pte Ltd (A subsidiary ofSNP Corporation) As part of our expansion plan, L we have vacancies for the following challenging positions: P He/She will assist in developing and executing marketing plans and promotional activities for books. Diploma in Marketing/GCE 'A' Level Min. 2 years' sales and marketing283 words
-
Advertisement765 1996-06-15 2 I Financial Controller Korea Major US Multinational I Attractive Package with Expatriate Benefits Our client is a leading multinational with global operations the Korean language is likely to be an important criterion for and a significant presence in the Asia-Pacific region. Continual selection. career development opportunities via job rotation for765 words
-
-
Page 3 Advertisements
-
Advertisement2332 1996-06-15 3 I You'll like it here. f fl#f mmk 'J*U rW^^. M Wr^ Location: BP Tower -Alexandra Road ._j Degree in Accountancy/Finance or equivalent •I"* ScniOr/i rOQUCt JC/Il^ineer '^^K^^^fl •l-2years l finance experience in a manufacturing Location" Ang Mo Kio/ B^^^. environment or public accounting advantageous l^B Good analytical, interpersonal and2,332 words
-
-
Page 4 Advertisements
-
Advertisement1390 1996-06-15 4 Confidentiality I" I Offices II Assured y <«m t Worldwide a TKK Consulting I Our client is a well established retail holding company with diverse interests in Our client is a well established cinema owner/operator who is also actively the consumer-oriented business. They are seeking a resourceful and dynamic engaged1,390 words
-
Advertisement570 1996-06-15 4 (smNGLSAI) The Premium Property Brand BAN HIN LEONG GROUP The Ban Hin Leong Qroup of companies is actively involved with the development and construction of residential properties. It's reputation for quality workmanship, innovativeness and commitment to provide homes of outstanding value has made it the premium property developer in Singapore,570 words
-
-
Page 5 Advertisements
-
Advertisement962 1996-06-15 5 I Breakthrough Opportunities '96 m^^W A tough act to follow. uJ^^^^^^^^^^^^^^^B BKjm.. ■> J I*l' I ■■■I Pi InkJet FAB Support AP Customer Support to be our driving force, you need a Degree in DeskJet Product t, m» m ir» i rr Business Administration (Marketing), Engineering Managers Channel Development Engineering962 words
-
-
Page 6 Advertisements
-
Advertisement829 1996-06-15 6 Career Opportunities In Asia Senior Financial Analysts American Multinational With A Global Presence Attractive remuneration with expatriate benefits <[ fl n Our client is a major US multinational with a network and/or other ASEAN languages. of manufacturing and marketing operations strategically located Thjs unj for professionals see king throughout the829 words
-
Advertisement8 1996-06-15 6 Sydney Wellington New York Toronto Vancouver London Johannesburg8 words
-
Advertisement377 1996-06-15 6 On behalf of our client, M/s Guthrie Properties (S) Pte Ltd, we wish to appoint a qualified personnel for our Guthrie House sth Avenue Condominium. Minimum of 5 years relevant experience in site supervision of M&E services in residential and commercial building. Minimum qualification of ITC certificate or preferably a377 words
-
Advertisement893 1996-06-15 6 Our client, a multinational company, is one of the leading international food product manufacturers. The company is rapidly gaining global market share and is positioned to expand its operations further. To support its continual expansion plans, it is seeking an independent and forward looking individual to join its management team893 words
-
-
Page 7 Advertisements
-
Advertisement847 1996-06-15 7 ©Client Services Manager Global Banking/Finance Software Solutions Group Our Client, an entrepreneurial US corporation with leading edge technology for software solutions in the banking and finance sector is seeking an outstanding Blue-Chip US individual. IT Group Based in Tokyo in this key management role, you will oversee a team of847 words
-
Advertisement703 1996-06-15 7 How you can shape the way the world lives and works. ■fJJ^^'^.y.^PM Every day, millions of people all over the world use Philips products. To make uH 4fcr J their lives and their work easier and better. Nothing would ior\ please us more. K II J-5 Except, perhaps, to have703 words
-
-
Page 8 Advertisements
-
Advertisement848 1996-06-15 8 Our client, a UK multinational and one of the leading players in the building materials business, is seeking ambitious and energetic people for the positions of: MM^^H^HJI^H Ref. E***** Reporting to the General Manager, your primary responsibility will be the profits MLA LSJ and oss tne company for Singapore. You848 words
-
Advertisement753 1996-06-15 8 I M-f I I I JCL^/ServicesPteLtd. ATA I Our client is a reputable organisation engaged in film making, entertainment products and the media services industry. In ensuring marketing service excellence, it seeks to appoint the following positions:I ASSISTANT VICE PRESIDENT OF I I MARKETING SERVICES I (AGENCY PARTNERSHIP DEVELOPMENT) (Ref:o7ii)753 words
-
Advertisement146 1996-06-15 8 I SPORTS OFFICER Sports For All I You will liaise with Constituency Sports Clubs and organise I Inter-Constituency and Intra-District Tournaments, Healthy I Lifestyle Programmes, Learn-to-Play Schemes, Sports for I Families, Women and Senior Citizens, and other mass I participation events. I Pre-requisltes: I A recognised University degree I Knowledge146 words
-
Advertisement555 1996-06-15 8 i 1) COSTING ASSISTANT To assist the Cost Accountant in financial and operational functions including cost analysis, overhead allocation, payment verification, etc. Diploma in Accountancy Knowledge in computerised accounting packages and Microsoft Excel Those with costing experience will have an advantage 2) BILLING ASSISTANT To handle billings for cable TV555 words
-
-
Page 9 Advertisements
-
Advertisement1250 1996-06-15 9 I ffißSd I FORGE AHEAD INTO NEW FRONTIERS I Technical Manager Senior Manager I Local or Expatriate Drug Registration, Asia MCS ***** MCSIIO66 Our client enjoys a worldwide recognition in its distinct leadership in the design, Our client, a world-leader engaged in the manufacturing and marketing of plasma development and1,250 words
-
Advertisement129 1996-06-15 9 A progressive company specialising In wholesaling and retailing of watches jewellery. Currently, we have the following position available: The selected candidate will assist In managing the Group's accounting, financial and tax functions including the following: Co-ordinating the overall financial and management accounting functions for all local overseas subsidiaries. Liaise with129 words
-
Advertisement139 1996-06-15 9 7b continue our rapid growth in the IT industry as well as our aggressive expansion plans, we are inviting high-calibre professionals to take-up the following challenge: t I EXECUTIVE OFFICER I Reporting directly to the managing director, the successful candidates MUST possess the following: A good Business Degree from a139 words
-
Advertisement107 1996-06-15 9 )MNMEW SYSTEMS PACIFIC, a subsidiary of a local public-listed group, is lookinc or ambitious individuals to join its pioneering staff in the following positions: At least 3 years of sales and marketing experience in computer and communications network At least a diploma holder Independent and well-versed in planning and strategy107 words
-
-
Page 10 Advertisements
-
Advertisement1297 1996-06-15 10 I innniTl If! IPQ TriTechMicroelectronics.Thismade-in-Singapore QFNinR/rAD FNRINFFRQ -v- -v i UPPUI lUI lIIICO IC Design company is singing a very different t^JE^ TriTCCh tune. Young, dynamic and Vibrant, we make our advanced electronic design automation tools used in IC jg/R fefe^ own decisions, Choose our own products, our design. You1,297 words
-
Advertisement268 1996-06-15 10 Are you a hands-on, experienced motor workshop manager? Do you have people management experience? If so, this could be the job for you: H^ZZT Service Manager (For a modern automotive workshop) Attractive Remuneration Package Car You will take charge of a well-equipped automotive workshop dedicated to providing superior service to268 words
-
Advertisement162 1996-06-15 10 0 ATTRACT POTENTIAL CANDIDATES with an ad in the limes columns I Call on us at toll-free 1800 741 1883 I or fax 741 1298 Phe Straits Times LAN Works pte Ltd for better business systems LANWorks is a NOVELL AUTHORISED SERVICE I CENTER with particular specialisation in advanced I162 words
-
-
Page 11 Advertisements
-
Advertisement710 1996-06-15 11 h I Banque Paribas I Banque Paribas, with group assets in excess of USD 260 billion, is a leading international "wholesale" Bank headquartered in Paris. Our presence in Singapore dates back over 20 years. As the Bank's regional center for the Asia Pacific, our Singapore office has over 250 staff710 words
-
Advertisement263 1996-06-15 11 SIEMENS Siemens, an MNC in Singapore reputed for highquality products in the high-tech electrical and electronics industry, has an excellent career opportunity for you: Planning Officer The Job: Material Planning and Control Provide material support to subcontractors Inventory control Sourcing of materials Requirements: Diploma in any Engineering discipline 1 2263 words
-
Advertisement696 1996-06-15 11 Sal t- f- "i I n^»i» -aff W? t k L=^9 f— »—^m w t W* «B'fl I it..__. m V* BB^TTa^F H^^^B l imiw n (^SNGAPORE'S MOST ADVANCED TECHNOPARK. IT'S THE PERFECT PLACE TO ADVANCE YOURSELF. Alexandra Technopark, our latest and most advanced industrial hi-tech park, is designed to696 words
-
-
Page 12 Advertisements
-
Advertisement1122 1996-06-15 12 High-end inspiration. At the Enterprise Storage Group, SENIOR FINANCIAL SYSTEM ANALYST ACCOUNTS CLERK PRODUCTION Western Digital's newest hard disk ANALYST Manufacturing Systems Fixed Assets/Cashier SUPERVISOR drive manufacturing facility in Your Challenges: Provide a^lkation su ortforthe to da (Permanent 2nd Shift) Singapore. Scheduled to produce its N^Si^lnforSn System maintenance oTfixtd assets1,122 words
-
Advertisement79 1996-06-15 12 Retirements Min Diploma holder, with 2 3 years experience in marketing Preferably in the field of repairs maintenance service of marine products Must be independent, results-oriented and service of marine products Good interpersonal and communication skills Promotes marine products, provides services for maintenance, operations to merchant fleet We of/era challenging79 words
-
Advertisement60 1996-06-15 12 |jf An well established company urgently requires: TH I PROORAMMIRi I Diploma in Computer Science and above V Age below 30 Bilingual Chinese English Attractive salary fringe benefits I < "interested applicants, please caii *>^ fl IC *****38 Ext. 261 J)M H walk-in interview at^^--^'^ Mm H HONG KONG TEAKWOOD60 words
-
Advertisement694 1996-06-15 12 ISM NATIONAL S#J UNIVERSITY OF SINGAPORE I Applications are invited for appointment to the i following position in the Dean's Office, Faculty of j Business Administration. SYSTEMS ANALYST ANALYST PROGRAMMER Dean's Office, Faculty of Business Administration Candidate should have a basic degree in Computer Science or related fields with at694 words
-
-
Page 13 Advertisements
-
Advertisement954 1996-06-15 13 We are expanding our IT Divison and as a result we are looking for experienced IT professionals to join our team as B^BB Ib^^H Bv 1 B^^BBT B^B^B^fl BV 1 B^BB k I B^^bl W B^Bb B^B^BB You are an IT Consultant. Your duties are to find the best candidates954 words
-
Advertisement84 1996-06-15 13 I FAR EAST ORGANIZATION 1 (HOTEL DVISIOH) Suitably qualified candidates are invited to apply I for the position of: I LCCI Higher Accounting or Diploma holders from Polytechnic, GCE 'A* or 'O' Level Some exposure to Property/Hotel industry an advantage Interested applicants should write in giving detailed resume including a84 words
-
Advertisement1293 1996-06-15 13 I Discover challenging and dynamic Hotel Walk-In Interview jj J^* Today, 15 June 1996 (9am spm) M W^^K^B Ik THE WESTIN STAMFORD Plßf^' ■■WIPIUM^ 2 STAMFORD ROAD SMMmPBH^^^Mi SINGAPORE *****2 ORD BLUNDELL ROOMS tt'l liliii LEVEL A W Yes, we've added a $123 million dollar investment to boost our Cathode1,293 words
-
-
Page 14 Advertisements
-
Advertisement73 1996-06-15 14 HI I lift Iff! I! tljji fllli f fiitlfl 111 H« O) I ]5 lll.liillll liiiiii ill 1 1 O MIM jl BIS alii II Sss!ntli al]h M I s S il» HI! tih 111! 1 Sllii If 11 i lilii I i 2 5 2 inlisri'M sifi ip! e73 words
-
-
Page 15 Advertisements
-
Advertisement2370 1996-06-15 15 I. Consultant/Senior IT 9. Senior Security Specialist 1 6. Technical Writer MjM AnalySt/IT Analyst You will drive and coordinate efforts to evolve You will be required to communicate in written (TnuriJL fr /H Ith nn>\ the "nfrastructural support for security services form the plans and strategies of NCB and IT2OOO2,370 words
-
Advertisement234 1996-06-15 15 SOFTWARE SOLUTIONS I Singapore Based Southeast Asia responsibility I Our client is a leading international software company, focused on messaging solutions for large, multi-platform, multi-network enterprises. Their messaging products enable companies to build robust, reliable, and scalable integrated messaging environments. They deliver software, consulting, and project implementation services for PTTs,234 words
-
-
Page 16 Advertisements
-
Advertisement1550 1996-06-15 16 (Gross Salary: Up to *****4 pm) tti IWiX Umf^XwlKuS^^f^k 1 8 l^r^llJli wMMJ USi lii SI *1 N Responsibilities: (Gross Salary: Up to *****7 pm) (Gross Salary: Up to *****7 pm) ig I'm -w- -y -fc design, develop, implement and maintain client- Responsibilities; Responsibilities: *J 1 If server applications, including1,550 words
-
Advertisement278 1996-06-15 16 Our client is one of the largest oil and gas producers in the world. With a traditional base in Europe, they are increasingly looking overseas for substantial new opportunities for growth. In this vein, their Asia Pacific office was opened in the early 1 990s to capitalise on the rapid278 words
-
-
Page 17 Advertisements
-
Advertisement753 1996-06-15 17 Lucent Technologies 1 B Bell Labs Innovations L LUCENT. ALLOW US TO SHED SOME LIGHT ON IT. PU LUCENT (ADJ) GLOWING WITH LIGHT, (N) MARKED BY CLARITY Clear thought, brightness and energy That sums up the talent Senior Technical Consultant Accounting Assistants and dedication of the people who make up753 words
-
Advertisement424 1996-06-15 17 Market Managers I New York FX/Money Markets London Credit Derivatives Markets Singapore/Hong Kong Credit Markets FX/Money Markets Knight-Ridder Financial is a leading player in the historical and product leadership expertise. Demonstrated ability in project real-time information business providing the highest quality management, achieving individual goals and working financial market news424 words
-
Advertisement109 1996-06-15 17 Fu Yu, the largest independent Mould Maker Ptastic Injection Moulder in Singapore has vacancies: SENIOR ENGINEER <!>«><«** Engine*^) Requirements: Degree/Diploma in Mechanical Engineering with 4-5 years' experience in Ptastic Injection Moulding Processes Must be able to work independently and lead a team of Engineers Responsibilities: I Strengthening process capability, testing109 words
-
-
Page 18 Advertisements
-
Advertisement887 1996-06-15 18 MdMNkMUtodA j MINISTRY OF NATIONAL DEVELOPMENT j^f APPLICATION FOR GRADUATE APPOINTMENT m m /A (A) POST(S) APPLIED FOR (In order of preference): %r^^MM m M /MW^(% mmW 2 3 ~W M f I V W Mm \B Bf e y° u prepared to consider posts other than those you have887 words
-
Advertisement245 1996-06-15 18 Boggle The Mind fflW— B— lW I Goto: http//www .smedia.com.sg Make a difference on the media frontier Sembawang Media is Singapore's leading internet publisher, producing sites for consumers and trade and professional users, receiving some 10,000,000 hits per month. Right now, we've got openings for the following positions: Art Director/Senior245 words
-
Advertisement338 1996-06-15 18 L A Local Precision Manufacturing Company is inviting 1 B suitable incumbent for the following positions: REQUIREMENTS: ft y e Bachelor in Mechanical Engineering W I Minimum 3 years relevant experience in tooling j design and software application A Specialise in CNC Milling CNC EDM Proficient in CAD/ CAM application338 words
-
-
Page 19 Advertisements
-
Advertisement642 1996-06-15 19 We are a leading distributor of high quality electronic components and cabling products in the Asean region, and we are currently looking for an: ASSISTANT ■Mn^Wni report to the Country Manager k j* -m-^ji- in Singapore and be I rt^^ responsible for all %aMM. 1 liJli l4 9 aspects relating642 words
-
Advertisement1245 1996-06-15 19 To motor i sts the automobile is an indispensable mode of transport. AMP is, in turn, indispensable to the automotive industry. Our interconnection components have been a vital part of almost every electric and, later, electronic appliance, machine and vehicle since 1 941 No wonder we're the world's largest i1,245 words
-
-
Page 20 Advertisements
-
Advertisement822 1996-06-15 20 Intel Networking Products It's Only Natural To Follow I A Leader HSBBj^H Internal Audit Manager i|J| (Asia-Pacific) w**%~ Key Responsibilities: Reporting to the Director of Audit based in the US, you will be responsible for the operation of the Singapore-based audit team. You will be required to deliver hands-on fjfl822 words
-
Advertisement275 1996-06-15 20 Maris is the world's largest manufacturer of refrigeration compressors, and has 120 corporate customers spread over 53 countries. We realise that people are our most important resource. That's why we aim to develop you to your fullest. Come to Maris, where you come first. H(l) ANALYST PROGRAMMER] Duties Requirements: Responsible275 words
-
Advertisement689 1996-06-15 20 To meet the Group's expansion plans, we are seeking dynamic professionals to join us as ASSISTANT MANAGER/SENIOR BUSINESS DEVELOPMENT OFFICER (Regional) You will be required to assist in the following: identify real estate business opportunities outside Singapore, prepare detailed feasibility studies and follow through projects from concept to reality, as689 words
-
-
Page 21 Advertisements
-
Advertisement773 1996-06-15 21 Standard Chartered We seek committed people who are looking for the best opportunities for growth. We offer a wide international network and a conducive working environment. Go for the best. Join us as: The Job: You will be responsible for ensuring that workflow processes are efficient and that there is773 words
-
Advertisement1053 1996-06-15 21 -~~*"2iii^SS3i^^l etui market{Location: Ang Mo Kio Industrial Park ll!) -A*ST Mobile Data is a provider of two-way wide area wireless data communication service in Singapore. jßiinfc ACCOUNT MANAGERS (Ref: AMOO3) The appointees will be involved in developing new business opportunities, servicing existing customers, conducting market analysis, account planning and formulation1,053 words
-
-
Page 22 Advertisements
-
Advertisement1058 1996-06-15 22 START YOUR CAREER ON FIRM GROUND A challenging career with great advancement prospects. These are what SIA can offer to those who aspire to excel with us. If an exciting career is what you are looking for, experience your success with SIA. TECHNICAL SERVICES ADMINISTRATIVE ENGINEER OFFICER cgenerausd Requirements Requirements1,058 words
-
Advertisement898 1996-06-15 22 W (it) TAT LEE BANK We Make Customers Our Friends. We invite applications for the following positions: I VICE PRESIDENT/ VICE PRESIDENT/ I ASST. VICE PRESIDENT ASST. VICE PRESIDENT (Computer Operations) (Corporate Finance) Responsible for the entire Computer Responsible for providing financial Data Operations of the Bank, which advisory services898 words
-
-
Page 23 Advertisements
-
Advertisement763 1996-06-15 23 JL B B 4C-4L JL JL ■■■re a leading finance company offering the full range of financial products including j deposits, share financing, car financing, housing loans, equipment financing, ship financing j md industrial/commercial property finance. We invite you to join our team of professionals as will be overall responsible763 words
-
Advertisement899 1996-06-15 23 Will the best Mechanical ill Engineering Honours IUL^ IBi Degree holders identify XJtf* yourselves? NUj MLji Black Decker is increasing its R&D capability in V Singapore. Our Singapore operations, which is the v| ta jm t T Eastern Hemisphere Headquarters, serves as the \3 l/^B innovative hub of the Asia-Pacific,899 words
-
-
Page 24 Advertisements
-
Advertisement1105 1996-06-15 24 5^ Singapore Telecom A career with Singapore Telecom places you at the forefront of global communications. You will play a key role in linking the world to Singapore by land, sea and air. Even now our submarine cables link us to two-thirds of the world, and our satellite earth stations1,105 words
-
Advertisement824 1996-06-15 24 Renowned MNC Group Jgj^^^RH Local and overseas coverage Excellent benefits package Our client is a leading international news and business information organisation. Using the most up-to-date technical know-how, they supply the global business and financial community with a wide range of products including real-time financial data, transaction systems, trading room824 words
-
-
Page 25 Advertisements
-
Advertisement842 1996-06-15 25 THE TOWERING FORCE 1 BEHIND TOP PERFORMERS, WING TAI LAND. Come discover your potential, and be Jk in the region; from business amazed at how far you can go. Wing JM development to feasibility studies; Tai Land is a wholly owned subsidiary M I from project development to property of842 words
-
Advertisement738 1996-06-15 25 1995 Winner tfVlll JiiC Equipment Engineer Responsibilities: Lead and supervise a team of technicians in the modification and upgrading of highly automated Assembly/Test equipment Develop and upgrade skills of technicians Assist in problem analysis and troubleshooting of line equipment Oversee equipment maintenance and implement Total Productive Maintenance program lll| Requirements:738 words
-
-
Page 26 Advertisements
-
Advertisement1042 1996-06-15 26 We are an affiliate of a leading muitinatj^^Hfefctal Company with marketing and manufacturing activities in S^H ■rvalues Is Diversity and International Foots. &l We value differences to Hsonality and style because Averse j|M ls ly to meet the needs Hk or 9 an sat on staffed bJB >th structure and1,042 words
-
Advertisement572 1996-06-15 26 CIVIL DEFENCE TTB-fIE LIFE SAVING FORCE Qualification WithNSF Without NSF M y^ V CAPTAIN (1) y/* M^ fi| Good Honours Degree $2676 $2342 y m|^^ j^f LIEUTENANT (1) Mr Honours Degree $2520 $2238 BWI.M Sm^T Pass Degree Merit $2238 $1904 I /j^Sr Pass Degree $2097 $1784 x **j Jfjf F572 words
-
-
Page 27 Advertisements
-
Advertisement690 1996-06-15 27 Manpower was founded in the USA in 1948 and today is the world leader in Employment Services. Our annual revenues exceed US$6.B billion, and we operate through 2,100 offices in 41 countries. Our client, a group of companies whose business is in international commodities trading, manufacturing, retailing and property is690 words
-
Advertisement596 1996-06-15 27 I A rewarding career. You have our word on it. ""~^t ZS-. 111 JPI Singapore Press Holdings isn't just the region's leading publisher of newspapers, magazines and periodicals. We're not just one of the top ten publicly-listed companies in Singapore but also a strong player in the multimedia and telecommunications596 words
-
-
Page 28 Advertisements
-
Advertisement850 1996-06-15 28 PRATT WHITNEY OTIS CARRIER HAMILTON STANDARD z BRVH UNITED UNITED TECHNOLOGIES pSMM TECHNOLOGIES CORPORATION (UTC) g fc %W^ INTERNATIONAI a Fortune top #31 multinational Corporation Vjj JlVZ^jl^ivlo 6 major operations units namely, /V*tf Q 44 ImHI OPERATIONS Whitney jet engines, Otis elevators, Carrier K- .air conditioners, Hamilton Standard g. flvfo/foff850 words
-
Advertisement532 1996-06-15 28 Wanted. 5 executives to fill 509 vacancies. From November 1996, there will be 509 new > Assistant Housekeepers vacancies for business travellers. All at the > p\ oor Supervisors Conrad International Singapore. > Guest Room Attendants This new international 5-star hotel is the Food Beverage latest in the Conrad International532 words
-
-
Page 29 Advertisements
-
Advertisement742 1996-06-15 29 t&* FUjfrsu ft We are expanding our computer systems support activities in the local and Asia-Pacific region to meet our I growing customers' needs in installation, testing, commissioning, data creation, operations and maintenance support, and training. 1 We are looking for: B]| iHOfIHIJ IIjWJ A Senior Engineer to support Merchandising742 words
-
Advertisement749 1996-06-15 29 A Enjoyable ji Honest Fan I No matter^B^Hßfc^^M^^"' 77 if Personal Integrity H Sr Jj|s k9 Balance JL ct^JZßZ^M^pm what thei ft i; 2r capacity, 9 sales representative deserve «9 iya^ Responsible for ASEAN sales channel including driving sales and tO bG 4Lt M^| marketing in the region; providing technical749 words
-
-
Page 30 Advertisements
-
Advertisement778 1996-06-15 30 *M Hutchison Hutchison IntraPage, a consortium of Intraco Limited, Teledata (S) Limited, and Hutchison Telecommunications Hong Kong Limited, will operate public paging services in early 1 997, The Hutchison IntraPage consortium has the global experience and expertise in international telecommunications and paging services to more than 10 countries including Asian778 words
-
Advertisement528 1996-06-15 30 nZL, Senior Manager SINGAPORE'S LEADING MAGAZINE 11/0011) t. r IfUilLlll 1S expanding, and we need dynamic people PUBLISHER, ft/, r DIICIiIECC on the Jff/i, with a keen nose tor DU 9INB99> yet publishes quitc at HOME in the rcalm of pgjlj}, FAMILIES UIDWABin NSIH6II If you fit the description, take528 words
-
Advertisement391 1996-06-15 30 Stanley Works Asia Pacific Pte Ltd is a fully owned subsidiary of Trie Stanley Works in U.S.A. We are the world's leading manufacturer and marketer of professionals hand tools. We have immediate vacancy for the positions of: Basic Purpose: Provide efficient and effective monitoring tracking on inventory level Responsibilities: Analyse391 words
-
-
Page 31 Advertisements
-
Advertisement504 1996-06-15 31 M C SERVICES piuvAiEiJMrreD We are a well-established professional service organisation providing corporate secretarial, share registration and general consultancy services to a wide range of businesses in Singapore. We invite suitably qualified candidates for the position of: Accounting Services Seniors Possess professional accounting qualification with good working experience in commercial504 words
-
Advertisement792 1996-06-15 31 KERRY OVERSEAS PROJECT MANAGEMENT LIMITED Assistant Project Manager Mechanical The incumbent will be stationed in Beijing, China, and work independently to provide support in building services to our hotel and commercial development. Applicants should be matured, self-motivated and have a degree/diploma in Mechanical Engineering or other related disciplines with at792 words
-
Advertisement973 1996-06-15 31 9k emporium group We are looking for individuals who want a challenging and self-fulfilling career. MIS DEPT Position 7: Head of Administration (Clemenli and Ceyiaag Bran*) Position 1: Analyst Programmers Th 1 J J b tl J Perform personnel job function such as Degree or Diploma in Computer Science payroll973 words
-
-
Page 32 Advertisements
-
Advertisement899 1996-06-15 32 JllL UOB LIFE ASSURANCE (A MEMBER OF THE UNITED OVERSEAS BANK GROUP) We are a fully-owned subsidiary of the UOB Group and are looking for dynamic and suitably qualified individuals to join us as: EXECUTIVE OFFICER ACTUARIAL SERVICES The successful candidate will be responsible for providing actuarial support, product development899 words
-
Advertisement674 1996-06-15 32 HintracQi Intraco, a public-listed company with diversified businesses in Engineering Projects, Telecommunications, Semiconductors, Automobiles, Commodities and Food Food Processing has immediate vacancies for: a. NETWORK ANALYST >. SYSTEMS ANALYST You will be part of the Information Systems team responsible for identifying and meeting the IT needs of the Company. You674 words
-
Advertisement633 1996-06-15 32 An expanding electronics company urgently needed the following positions in Hong Kong, China and Singapore. (Working Location: Station in Shenzhen China) Minimum 2 years of working experience in I; Electronics Manufacturing environment Knowledge of ISO-9000 are preferred University graduate Good command of both spoken and written I English and Mandarin633 words
-
-
Page 33 Advertisements
-
Advertisement596 1996-06-15 33 0 SYSDECO A listed multi-national company with emphasis on developing mission-critical I systems invites applications for the following posts:--•l ■■■■■■■■■■■■■■■■I BCI iCI II ma FtTVfikl Ih iCI I I The successful candidates will be responsible I for designing, developing and maintaining I new and existing application software systems I for596 words
-
Advertisement921 1996-06-15 33 g£ Technochem Manufacturers is a joint-venture between Sime Singapore I IHi JW| w\ and SiSIR International, a subsidiary of PSB. We are one of the largest fi^S^^Ml industrial waste management and recycling companies in this region. llHf^fc^Wl Our core activities centre around the treatment and recycling ofPCB VMttMfßprf etchants and921 words
-
Advertisement829 1996-06-15 33 r— SHANGRI-LA HOTELS AND RESORTS is an expanding group of Deluxe Hotels and Resorts in the Asia-Pacific region, consistently recognised as one of the world's leading hotel groups. SHANGRI-LA HOTEL. SINGAPORE set in beautifully landscaped tropical gardens, a stroll away from the world renowned Orchard Road shopping belt, has over829 words
-
-
Page 34 Advertisements
-
Advertisement771 1996-06-15 34 SIEMENS Siemens is one of the Applicants must have a world's leading compa- good working knowledge nies in the field of elec- of major office and trical engineering and engineering system electronics providing high platforms. Knowledge of quality products and UNIX databases, NT services for many and DOS Window softapplications,771 words
-
Advertisement1286 1996-06-15 34 I Hlsime 1 ASSURANCE W We are a member of a large w I international insurance group in KS j Singapore offering a 5-day work week nm I and an attractive salary and benefit We are looking for a mature and IB 1 experienced Analyst Programmer. The i selected candidate1,286 words
-
-
Page 35 Advertisements
-
Advertisement663 1996-06-15 35 m/mm ISgHb SINGAPORE SCIENCE CENTRE I Applications from suitably qualified I candidates are invited for the following positions: ASSISTANT SCIENTIFIC i OFFICER I (Bron Monthly Salary: SI ,595- $3,062) Responsibilities: •To plan and develop exhibits for the various exhibition galleries •To organise and conduct science education programmes, eg. lecture demonstrations,663 words
-
Advertisement526 1996-06-15 35 ™")S3F^ Premium I Media Technology I Creates Ul' jEk Premium Hi c^ f^fflyij Careers. Wjtk CDO Singapore Pte Ltd is now part of the Seagate family jfcfl following the merger of Seagate and Conner. This, with the j/pfl media plant in Woodlands, represents the start-up of Kfifi Seagate's Recording Media526 words
-
Advertisement93 1996-06-15 35 E A Member of the Hitachi Groop of B Production Engrg Dept I Mate bebw 35 years old I Degree in Electronic/Electrical Engrg I Fresh graduates are vv^lcome to apply I Q4 Dept I Diploma in Eiedrowc/Ekclricd/Medionical Engrg I Experience in QA/QC areas preferred I* NTC 3 in Electronic Servicing93 words
-
Advertisement919 1996-06-15 35 J^ Singapore Technologies I #iii^ Aerospace I Creating value for you worldwide We are looking for suitable candidates to fill the following positions in our Engineering and Development Centre: SENIOR ENGINEERS/ENGINEERS Experience in computer programming is an (Ebdritol/Bedronlo) added advantage r Successful candidates shall design and Degree in ElectncaUElecironics Eng.neer.ng.919 words
-
-
Page 36 Advertisements
-
Advertisement750 1996-06-15 36 a I Keppel Corporation Limited Keppel Corporation is an international conglomerate with eleven publicly listed companies engaged in shiprepair and shipbuilding, rigbuilding, property, banking financial services, shipping, logistics services, telecommunications and engineering. We invite suitably qualified candidates to apply for the following positions: The successful applicant will report to the750 words
-
Advertisement817 1996-06-15 36 Dialogic, the world's leading supplier of computer telephony platforms is expanding it's Asia Pacific operations. Interested parties are invited to apply for the following positions: FIELD APPLICATIONS ENGINEER The Field Applications Engineer will work closely with the Sales Team to support Dialogic's Sales Accounts in the Asia/Pacific region. The FAE817 words
-
Advertisement590 1996-06-15 36 manufacturing company require^^^H I Qualifications; O Degree in Mechanical Engineering Physics with min. I 2 years experience of directly related industrial sales I engineering. Preferable in Electronics Industry with I metal stamping precision machining experience. O Creative verbal and written skills required I a Must exhibit strong knowledge of computer590 words
-
-
Page 37 Advertisements
-
Advertisement591 1996-06-15 37 BBBH \HCKERS HHRHBGHH a trimova commit TICKERS SYSTEMS, a world leader in the manufacturing and marketing of hydraulic components and systems is seeking to appoint the following personnel for its expanding operation. Degree or Diploma in Mechanical or Industrial Engineering Sound practical engineering background In developing new applications Capable of591 words
-
Advertisement848 1996-06-15 37 SENTOSA DEVELOPMENT CORPORATION I Sentosa is the region's leading tourist attraction and a favourite recreational I playground for Singaporeans. Staying ahead as the market leader requires a proI active management team able to rise to the challenges of a highly competitive and I rapidly changing environment. We seek the following848 words
-
Advertisement78 1996-06-15 37 POUMRCUP B^Sornerseivlcedepc^^l jJPWn Ito Improve service levels to Supply to Management data and recommendations to enhance the profitability of the business J|^ Uaise with customers and ir HaH§|L departments £j< \os Sales administration repon |<;> *k Supervise motivate numtfl f in the department fl I Requirements j M m I78 words
-
Advertisement749 1996-06-15 37 TSF C|TY I DEVELOPMENTS H the lar 9 est listed P r °P ert y company in Singapore, I I we own and manage a diversified portfolio of residential, fW commercial and industrial properties. Poised to be a 31 H* I leading conglomerate in the Asia Pacific region, we are749 words
-
-
Page 38 Advertisements
-
Advertisement931 1996-06-15 38 We are one of the largest independent integrated IT services group of companies operating in I 30 countries worldwide and listed on the Stock Exchange. To achieve our mission of enhancing the competitive position of our clients by equipping them with state-of-the-art IT solutions and continuously servicing them with a931 words
-
Advertisement1145 1996-06-15 38 The Leading First Stop Enterprise Centre Join our expanding enterprise development team and take up the challenge of growing local enterprises from SMEs, PLEs to MNCs! EPC is a private extension of our governments multi-agency network to develop local enterprises. We render hands-on assistance to business, ranging from facilitation K1,145 words
-
Advertisement818 1996-06-15 38 I ING«ii)BANK ING Bank is the banking arm of ING Group, one of the f major financial institutions in Europe. We operate an international network of over 60 offices in more than 30 countries. The growing presence of ING Bank in the world's fastest developing regions Asia, Latin America, Central818 words
-
-
Page 39 Advertisements
-
Advertisement584 1996-06-15 39 SSS3S An established local MNC dealing with ink, "|§s dwrnkaiandsoiderproductsßim^suitabie Degree holder. Those with Diploma in Personnel Management will be advantageous At least 2 years of relevant experience Possess good interpersonal skills and able to work independently Computer literate and knowledge of EasyPay 3 Conversant with local labour law Accountancy584 words
-
Advertisement731 1996-06-15 39 ■■■■ight years ago, we launched TradeNet, a nation-wide communication information network which revolutionised trade-related industries. Today, we continue to drive the IT industry forward in sectors such as manufacturing, healthcare, legal and retail. Combining cutting edge technology and the keenest minds, we are set to take on the world. So731 words
-
Advertisement617 1996-06-15 39 Too Big A Size To Wear? ijtjMJ You Might Just Fit In a Fortune 500 company and the wjbild^ largest Wr^*2rP^^^S«« branded apparel manufacturer with over US$6 billion ,JC I in annual sates. Operating worldwide It Is known for I V^fl, j^^Of^^T its commercial success an* He commitment to the617 words
-
-
Page 40 Advertisements
-
Advertisement1217 1996-06-15 40 ANY HUBKHIH) INDIVIDUAL WILL BO FOR THE PROVEN AND THE SURE-FOmEP. MobileLink and PageLink. Created to provide excellence and continuity in cellular and paging communications services which the Singapore Telecom Group is renowned for in the Republic. We've a long proven history of professional experience and maturity that is vital1,217 words
-
Advertisement157 1996-06-15 40 IHongkongßank iZt 1 The Hongkong and Shanghai Banking Corporation Limited MrmbtrHSVCGmup HSBC GROUP We are looking for dynamic sales marketing officers with high drive, excellent communication skills and a successful track record in property, equipment shipping finance to join our Finance division as: MARKETING MANAGER, EQUIPMENT SHIPPING Applicants will have157 words
-
Advertisement127 1996-06-15 40 I MG I IVANHQE CAPITAL PTELTD Invites applications for the following position: I ¥Sz KB I The successful candidate should meet the following requirements: i Singapore Citizen or Permanent Resident Between 25 to 35 years old At least 3 years regional and international flight experience with major airlines Be able127 words
-
Advertisement100 1996-06-15 40 An established Japanese Interior Design M and Construction Company urgently requires: Diploma holder or equivalent with minimum 2 years experience in interior/architectural designing Experience in interior construction detailing a pre-requisite Good in co-ordination and presentation skills with a pleasant personality Preferably female Must be a team player A good remuneration100 words
-
-
Page 41 Advertisements
-
Advertisement684 1996-06-15 41 SIMEX An International Financial Futures Exchange SIMEX, Asia's first financial futures exchange inaugurated in 1984, is a leading exchange offering a wide range of financial and energy futures products for international participants. Those who seek employment in the financial futures industry can look forward to working in a dynamic, rapidly684 words
-
Advertisement702 1996-06-15 41 APPOINTMENTS/NOTICES I A leading local Bank in Hong Kong is setting up an Offshore Banking Branch in Singapore and would like to invite applications for the posts of: Accounting Officer Responsibilities: W^^ Handle maintenance of proper accounting system and records Prepare financial statements in accordance with statutory and Head Office702 words
-
Advertisement726 1996-06-15 41 SENTOSA DEVELOPMENT CORPORATION I Sentosa Development Corporation is constantly facing new challenges as I the leisure and tourism Industry becomes more demanding and sophisticated. The statutory board has undergone very rapid changes in the last year In its I quest to be more market-driven. The first phase of this programme726 words
-
Advertisement84 1996-06-15 41 We are a subsidiary of a Singapore Multinational, manufacturing products for the HVAC and related industries. Due to expansion, we are looking for a result-oriented individual to join us as: Soles Engineer Mechanical Engineering background 2 years' experience in the air-conditioning industry dealing with consultants contractors preferred Possess own car84 words
-
-
Page 42 Advertisements
-
Advertisement756 1996-06-15 42 I %l#estpac I I WESTPAC BANKING CORPORATION, Australia's first bank, has offshore I I operations in strategic Asian financial centres. The Singapore Branch Regional Office I I is looking for a suitable candidate to join our Corporate Finance team as: I Principal Responsibilities: The incumbent will service the banking and756 words
-
Advertisement34 1996-06-15 42 Any Job. Any Career. Available Any Day. Anytime. Anywhere. Fffitarl p| The Straits Times The Sunday Times Business Times The New Paper LIANHE ZAOBAO LIANHE WANBAO SHIN MIN DAILY NEWS Berita Harian Berita minggu34 words
-
Advertisement607 1996-06-15 42 With Our Impeccable History, aiMiMuwiuiumum \*V^ I I K f "*^l t" Pounded in 1897, Becton Dickinson has been l^h F^I*OID€^II4^Cj makin s waves the 13 *-*J"*^-'"^''*-* global healthcare industry. "IVj Mp%A/ In 1952,we sparked off a revolution in medical II gfv 1a -fl-^> care with our perfection of B607 words
-
Advertisement747 1996-06-15 42 fill NGEE ANN I^} (A) ALPHA Centre Rl Diploma in Electronic Engineering or Electronic and Computer Engineering Preferably conversant and experienced in C language programming for PC-based and embedded systems (B) Estates and Development office Diploma in Building Services Engineering, Electrical Engineering or Mechanical Engineering At least 2 to 3747 words
-
-
Page 43 Advertisements
-
Advertisement1810 1996-06-15 43 Outstanding Career Opportunities With I I The World Leader In Applying Information Technology. I EDS (Electronic Data Systems) is a global leader in the information technology services industry with annual revenues exceeding US$l2 billion. Established in 1962 and headquartered in Dallas, Texas, USA, we employ over 90,000 people serving customers1,810 words
-
-
Page 44 Advertisements
-
Advertisement808 1996-06-15 44 4 AlliedSignal (S) x ADVANCED ViX MATERIALS TiS-^T B We need People Mo Can Deliver Our Promise B AlliedSignal Laminate Systems, a subsidiary of a Fortune 500 multinational, has always been in the limelight through serving one of the worlds most demanding industry, The Printed Circuitry Board Industries. In our808 words
-
Advertisement5 1996-06-15 44 i APPOINTMENT ADS jRPORATE MARCHY5 words
-
Advertisement503 1996-06-15 44 Dresdner Bank HHK, Dresdner Bank is the second largest bank in Germany with a strong global presence. To meet the needs of our growing team in Singapore, we seek qualified Credit Professionals to join our Credit team which has regional responsibility for Asia. As part of the credit team, you503 words
-
Advertisement484 1996-06-15 44 Since its inception in 1986, D-Link Corporation has been dedicated to the development, manufacturing and marketing of Computer Networking products. D-Link has successfully fielded challenges from other vendors, and sales revenues worldwide have grown on an average of 50% every year for the last nine years. The regional headquarters in484 words
-
-
Page 45 Advertisements
-
Advertisement20 1996-06-15 45 E F F E C T I V E E C R U I T M E N T TheStraitsTimes20 words
-
Advertisement709 1996-06-15 45 dp jriJejri EMBARK ON A CAREER THAT WILL SURVIVE EVERY CHALLENGE A career with AEA International, the largest assistance company in the region and one of the largest in the world, means facing challenges ever so often. Whether they be medical, travel, legal, automobile or home emergencies, we are able709 words
-
Advertisement559 1996-06-15 45 A major property developer, Straits Steamship Land (SSL) has a diversified and expanding portfolio of quality properties in ten countries worldwide. For that distinctive SSL quality in all our projects, we seek out professionals of exceptional calibre who are ready to take on the challenge of carving out a mark559 words
-
Advertisement766 1996-06-15 45 Global in business. Regional in operations. Personal in approach. In this newly-created position, your main responsibilities will be to trade G7 currencies in the repo market and help to develop new products/market in repo. You would also be handling the administrative work arising from your primary activities in this job.766 words
-
-
Page 46 Advertisements
-
Advertisement688 1996-06-15 46 J > MML 4 I IS ij/jnpT^*yj IT ipMI 6 j One of the world's leading investment banks, Swiss Bank Corporation has a strong reputation for performance and security. Working with us, you'll find that we consciously aim to enhance this reputation. This in fact makes you one of the688 words
-
Advertisement778 1996-06-15 46 I nrs I Health Corporation of Singapore Pte Ltd Health Corporation of Singapore Pte Ltd is the holding company of 5 restructured hospitals and 2 outpatient facilities. Our Mission is to own and manage an efficient network of health care institutions, through which an excellent level of health and medical778 words
-
Advertisement767 1996-06-15 46 f Grow With Dynamic SPEEDY-TECH We, an established and fast growing group of companies 4m gjPl with manufacturing operations in Singapore, China and w\ Philippines, are looking for a self-motivated and j—% committed individual to join our management team. *^A A very good prospect of career advancement awaits the right767 words
-
-
Page 47 Advertisements
-
Advertisement10 1996-06-15 47 H 3 J 3 A > (D 0 0 si APPOffTMBfTS/NOfTKES10 words
-
Advertisement501 1996-06-15 47 A leading multinational insurance organisation is looking for suitably I qualified candidates for the following positions: iVxARivJLTIJN Cjt JeLalLv> U 1 1 V mL m v *n I rlf* &\nn «:^»ip*; of travpl related insurance Droducts You should possess a degree/diploma and at least 3 years' sales I experience or501 words
-
Advertisement752 1996-06-15 47 WHIRLPOOL IS POWERED BY PEOPLE. AND WE ARE ALWAYS INTERESTED IN MEETING TOP-CAUBRE PEOPLE WITH THE RIGHT COMBINATION OF TALENT COMMITMENT TO JOIN US. Reporting to the Senior Manager, Regional Reporting Analysis, the ideal candidate will work with the regional financial consolidation reporting and budgeting for Pan Asia Cost Centers752 words
-
Advertisement622 1996-06-15 47 3M Develop your career in a leading US-based Fortune 500 multinational company in Singapore. We have immediate openings for the following positions: IT CO-ORDINATOR (End-User Support) You will be responsible for performing LAN administration, installation and user support. Requirements: Diploma in Computer Studies 1-3 years' working experience PC networking knowledge,622 words
-
-
Page 48 Advertisements
-
Advertisement728 1996-06-15 48 LEADER IN EDUCATIONAL TECHNOLOGY EONOVATION'S corporate mission is to apply innovative IT solutions to education. Headquartered in Singapore, we have offices in USA, Malaysia and Taiwan. Our products range from CD-ROMs to networked learning systems. We are a partner of the National Computer Board and the Ministry of Education in728 words
-
Advertisement787 1996-06-15 48 In Singapore, Glaxo Wellcome has major IRirl W^Wf operations including manufacturing, sales I"u3 I and marketing, and regional management i In the area of manufacturing, Glaxo Wellcome HPH has two plants costing $450 million which use state-of-the-art technology and equipment to manufacture pharmaceutical compounds. It is investing another $125 million787 words
-
Advertisement742 1996-06-15 48 I 0 I Unilever Unilever is an Anglo-Dutch multinational company engaged in the manufacturing and marketing of fast-moving consumer goods. as one of the leading companies in the fortune 500 list, we have built a wide range of successful brands like Upton, Wall's, Pond's, Lux and Organics. We are looking742 words
-
Advertisement9 1996-06-15 48 cd sd ft* 02 fix 53 S3 02 APPOMTIENTS/NQfTCES9 words
-
-
Page 49 Advertisements
-
Advertisement619 1996-06-15 49 Honeywell is a multinational organisation with main business activities in Space Aviation, Home Building Control and Industrial Automation Control systems. Part of the Honeywell group of companies is Honeywell Safety Management Systems Re. Ltd. Based in Singapore, they act as the Regional Application Center for the marketing and design of619 words
-
Advertisement89 1996-06-15 49 Applicants with the following qualifications are invited for the above position: Excellent Typist Ability to use transcriber Good English Need Appearance Ability to take charge organize Knowledge of typing, documentation (with or without) Ability to work independently Please forward your C.V. stating current expected salary together with a recent photo89 words
-
Advertisement740 1996-06-15 49 'Building A World-Class Land Transport System' We are looking for people with driving ambitions to realise our vision of providing Singapore with a world-class land transport system. We invite you to be part of the team to undertake the bold challenge of solving tomorrow's transport problems TODAY. Manager, Property Development740 words
-
Advertisement652 1996-06-15 49 »a iaiiißgK EB 1 .*aj^Sm^ej-. I Be part of the international team at Reuters, the leading jS^^- JJj international news and business information ,j|jH B^r9j|| organisation. Using the latest technology, we supply iflH PfCr the global business community and news media %ffl with a wide range of products including real-time652 words
-
Page 50 Advertisements
-
Advertisement618 1996-06-15 50 Overseas Union Bank Ltd invites applications for appointments in the following areas: 1 BANK SECURITY The successful candidate will be responsible for ensuring the smooth operations of the security and fire systems of the Bank's premises as well as supervising security personnel. Applicants should have at least 3-5 years' relevant618 words
-
Advertisement595 1996-06-15 50 Mitutoyo's Regional Headquarters for South I\jt__ East/West Asia, in its continuous strive to service the manufacturing industries in general and IQA line in particular, I 'pield Senvice, SttqitteeM,/ To install cajiurate and commission high-end precision measuring machines in this region. Candidates should: possess Diploma in Mechanical or Electronic Engineering with595 words
-
Advertisement599 1996-06-15 50 WAttachmate Attachmate The Intranet Company™ is a leading provider of high quality universal information access software and services that help organizations build INIIIIIHIIIII secure internal networks. The company's object-oriented client/server, authoring tool and management software safely link enterprise systems, Internet systems and people. These solutions allow desktop and mobile users599 words
-
Advertisement17 1996-06-15 50 E F F E C T I V E C U I T M N T rh^traifc^imes17 words
-
-
Page 51 Advertisements
-
Advertisement12 1996-06-15 51 w CD ft* CD o sd io CD cd CD TheSbtefas AR^ONTMQffS/NOTICES12 words
-
Advertisement574 1996-06-15 51 (~WmtZ ITJLMJKZ Hedreioijjipn^uS ■*>. i-s^ niltiiitieiil engaged ii the dmmmb vXm Tsawss VSiiV CMwymdcoatroleledricil The Job energy pobe. We m Reporting to the Manufacturing Manager, \*^U experiencing rapid you will: \j^ \^^l M P IMioI hst nr be responsible for the transfer of \"O xi&Sftk rBftll new process to manufacturing574 words
-
Advertisement670 1996-06-15 51 Mecomb Singapore Limited, an industrial leader in providing sales and servicing of a wide range of electronic, industrial automation, communications, electrical and mechanical equipment, invites you to join our core team of engineers. The successful candidate will be responsible for leading and developing a team of sales and application engineers670 words
-
Advertisement798 1996-06-15 51 The National Sip] University X^jy of Singapore Founded 1905 Applications are invited for appointment to the posts of Technical Officer (Information Technology) in the following areas at our Computer Centre: 1) NETWORKING 2) HELPDESK MANAGEMENT 3) ADMINISTRATIVE OFFICE INFORMATION SYSTEMS 4) SPECIAL PROJECTS GROUP QUALIFICATIONS Ngee Ann Polytechnic Diploma in798 words
-
-
Page 52 Advertisements
-
Advertisement734 1996-06-15 52 mm national S^ UNIVERSITY M*T OF SINGAPORE Applications are invited for appointment to the posts of: 1. ADMINISTRATIVE OFFICER Personnel Department 2. ADMINISTRATIVE OFFICER Planning Services Unit 3. ADMINISTRATIVE OFFICER Faculty of Engineering 4. ADMINISTRATIVE OFFICER Faculty of Law 5. ADMINISTRATIVE OFFICER Alumni Affairs and Development Office Qualifications/Experience/Puties: Candidates should734 words
-
Advertisement785 1996-06-15 52 KK Hospnal... pn women and soon pn chldnen as well KK Hospital, the Singapore Women's Hospital since 1924, will be moving into new premises in the near future. We will then be a specialist hospital for both women and children. And with our growth and expansion, come more meaningful ways785 words
-
Advertisement634 1996-06-15 52 II #NIKKO The Nikko Futures (Singapore) Re Ltd (a wholly owned subsidiary of The Nikko Securities Co., Ltd, Tokyo) invites applications for the positions of: I The fob: Responsible for the entire back office operations. Duties include: Trade processing and reconciliations Monitoring of customer fund flows, statements, margin Preparation of634 words
-
-
Page 53 Advertisements
-
Advertisement709 1996-06-15 53 EFFECTIVE RECRUITMENT ADVERTISING. ITS ONLY A CALL AWAY... To advertise your IA B t in ■■■■liliiMi I Trsinii OTNOIICOS, oflHtoH Iroo 1-800-741-1883 j The BfamtomTlme* ij An established Construction and Trading Company has vacancies for the following positions for granite quarry project in South East Asia: DUARRY PRODUCTION Those who709 words
-
Advertisement147 1996-06-15 53 Longman Singapore is one of the leading local educational publishers. We are seeking creative and highly-motivated people to join our progressive editorial team as ccsitors/caiioriai Assisiams The job will involve overseeing the editorial process from manuscript delivery to publication; editing and re-writing text; proofreading; carrying out market research; sourcing for147 words
-
Advertisement754 1996-06-15 53 SRS As part of A. C. Nielson, the global leader in providing marketplace intelligence, Survey Research Singapore is committed to offering first class employment opportunities for talented people. Market Research Managers Vttu will report to the respective Research Directors and lead a small team of Research Executives working on a754 words
-
Advertisement627 1996-06-15 53 d Jk, SINGAPORE C KA institute of 1 MANAGEMENT Owing to expansion, the Institute would like to invite suitably qualified applicants for the following positions: Responsibilities The successful candidate will be required to supervise the day to day operation of the library, coordinate the collection development programme, and participate in627 words
-
-
Page 54 Advertisements
-
Advertisement590 1996-06-15 54 |3M We have immediate openings for the following positions. These positions are for a newly established company a spin-off from 3M located at New Industrial Road. I CUSTOMER SUPPORT ENGINEER (Printing) You will provide installation, maintenance and professional services, as well as end-user training for a range of equipment, particularly590 words
-
Advertisement694 1996-06-15 54 I BERGER 1 feSJ INTERNATIONAL £w GENERAL MANAGER 1 333 Two Positions >j^S) v^ (to be based in China) jji<£ Ms This is an outstanding opportunity to join one of the world's well-known paint groups during its exciting expansion phase. :Sc^ C^/ Berger International Limited is listed on the Singapore694 words
-
Advertisement726 1996-06-15 54 HI6 W» We are a rapidly-growing company which develops, manufactures sells computer-based equipment for the pre-press industry. Due to business expansion, we are seeking the following additional position in our Singapore regional office: Support Engineer The Job: The successful candidate will offer a first-line response services to our customers using726 words
-
Advertisement131 1996-06-15 54 mm Z tee* w*****M CD ™^S tiii.i -ICD j*m yam* CD CD MImWBWM 4 TheStraitslSmee APPOtfTMENTSNOITICES ONG FIRST CHICAGO FUTURES RE LTD A SIMEX Corporate Clearing Member invites applicants to apply for the posts of: TRAINEE DEALERS HI Requirements: Japanese but must be fluent in English with or without experience131 words
-
-
Page 55 Advertisements
-
Advertisement105 1996-06-15 55 1 I -B i B i i i i i I i I i I i I KB i ■I I HI I I I I I I I i BB I i Senior Account Executive/ Account Manager Leading international advertising agency looking for young and energetic advertising executives to105 words
-
Advertisement593 1996-06-15 55 INGJi£)BANK ING Bank, part of the ING Group, is one of the largest and fast expanding European financial institutions in the world. And we offer good career prospects for the right candidate. ING Bank invites suitably qualified candidates for the position of: for its Regional Office. Singapore, which has responsibilities593 words
-
Advertisement677 1996-06-15 55 K Keppel Bank (A member of the Keppel Group) As a dynamic and fast growing Bank k we are able to offer you a challenging career. We would like to invite suitably qualified applicants to apply for the following position: ASSISTANT VICE PRESIDENTS Responsibilities: Market the Bank's financial services to677 words
-
Advertisement572 1996-06-15 55 K CAREER IN BANKING FOR POLYTECHNIC GRADUATES OUB invites applications for appointment as: ASSISTANT OFFICER MANAGEMENT INFORMATION SUPPORT Position (1) The successful candidate will be supporting a team of analysts in management and regulatory reporting. Other responsibilities include financial forcasting, costing, budgeting, variance analysis and statistical support to business managers.572 words
-
-
Page 56 Advertisements
-
Advertisement696 1996-06-15 56 EG&G Heimann Optoelectronics, IftkCSrT a technology-driven company, is looking for suitably qualified W^^ Wk candidates for the following positions: VT/Jflnn^ Requirements; IjK^^^a Degree/Diploma in Mechanical Engineering Minimum 4 years' working experience in a design and automation environment Knowledge of ACAD is essential Knowledge of PLC will be an added advantage696 words
-
Advertisement536 1996-06-15 56 451 FAR EAST LEVINCSTON I BP SHIPBUILDING LTD I FELS (A member of the Keppel Group) We are the world leader in the turnkey design and construction of offshore rigs and platforms and other engineering structures.Due to the expansion in our business activities, we are looking for high calibre individuals536 words
-
Advertisement685 1996-06-15 56 I CHANGI INTERNATIONAL LOGISTICS CENTRE LTD 1 (A lolnt-venture of CIAS Enterprise, APLS. MSAS and Slme Singapore) We are a progressive warehousing logistics I company, servicing high value industries including I pharmaceutical, medical, electronics and I aerospace, machinery and electronics parts as well I as upmarket retail sectors. In our685 words
-
Advertisement167 1996-06-15 56 1 Ilw I 1 m ih II i n iIUIVH I i nin m I Ilk k I ILL LLTLLu i Tffj i I I International trading house in grains, animal feed*, fertilizers, etc. is looking for a young and dynamic person to join our team as: Person should have167 words
-
-
Page 57 Advertisements
-
Advertisement565 1996-06-15 57 H /AVAXCgKUDCERa II Your Challenge: Reporting to the Marketing Communications Executive, you will assist in organising advertising and promotional activities. These include exhibitions, seminars, production of in-house newsletters, product brochure and promotion leaflets. Your Credentials: Tertiary education in Mass Communications Jm Min. 3 years 1 experience in A&P activities ■k565 words
-
Advertisement175 1996-06-15 57 SALES MANAGER (1 POSITION) 9 SALES EXECUTIVE \ENGINEER (1 POSITION) We are a trading, sale and marketing arm of a established group of O\ companies which deal with flexible printed t circuits. We are looking for above positions to reinforce our sales team. The incumbent will be responsible for i175 words
-
Advertisement809 1996-06-15 57 JBI We are the largest privately owned property developer and homes provider in fi] BJI Singapore. Established more than 30 years ago, the Organization currently has a BJ IS staff strength of over 2,500 people. Our other major businesses include hotel 5! IB service apartment operations, finance-related services and food809 words
-
Advertisement737 1996-06-15 57 ■■■■■■■■MHnBHHHHHHi JPMorgan It's the character. Beyond Capabilities Services That makes J. P. Morgan one of the most exciting financial institutions to work for in the world. Our principles of ethics, respect, teamwork, development, merit and excellence distinguish us as a choice employer. They define a commitment to people founded on737 words
-
-
Page 58 Advertisements
-
Advertisement720 1996-06-15 58 GREAT EASTERN LIFE is today the leading life insurer backed by the largest asset base in the region. It is strong, solid and progressive. To support our growing operations, we are looking for suitably qualified candidates (Singapore Citizens Permanent Residents) for the following positions: EXECUTIVES (Investment Administration Secretariat) The successful720 words
-
Advertisement623 1996-06-15 58 SINGAPORE POOLS (PRIVATE) LIMITED invites suitably qualified candidates for the following positions: Position A The Job You will develop concepts and liaise with agencies for visual projections and advertisements in various forms with emphasis on corporate image propagation. You are also required to provide administrative support and execute and oversee623 words
-
Advertisement645 1996-06-15 58 M A leading IT consultancy company is seeking to enlarge its Singapore m operations and support its regional expansion. We are inviting applications I from the young ambitious individuals for the following positions. You will be involved in project implementation, pre-sales activities, bm technical support and training. Successful applicants will645 words
-
Advertisement15 1996-06-15 58 j 4-i '3 U h uj 0 JJ: •h C5 zlu TheStraitsHmesi APPOWTMEKTSWOnCES I 3i.15 words
-
-
Page 59 Advertisements
-
Advertisement740 1996-06-15 59 m A leading American MNC dealing in the oil and gas industry is gf in urgent need of the following personnel. jJ lA. SERVICE COORDINATOR I I Candidate will assist the Regional Service Manager with the day to day operations and provide support in quotations, ordering and delivery of parts,740 words
-
Advertisement641 1996-06-15 59 We are looking for technically competent site staff for the following posts:- I I Recognised University Degree in Building Services or Mechanical Engineering I Minimum 5 years of relevant working site experience in Building Services Installation and minimum 3 years' experience in site management I Recognised Certificate in Building Services641 words
-
Advertisement819 1996-06-15 59 •Jiff- UNITED OVERSEAS BANK GROUP We are Singapore's leading bank Group, providing an extensive range of finance-related services, with a progressive workforce dedicated to work excellence and quality service. We invite applications for the posts of: MARKETING MANAGERS AND OFFICERS The successful candidates will be responsible for marketing and credit819 words
-
Page 60 Advertisements
-
Advertisement627 1996-06-15 60 We are a leading supplier of electronic manufacturing and semiconductor^^ ■T equipment. The company has become well established over the past V 10 years and has regional offices in Asia. We are currently looking for suitably qualified and experienced candidates to support our aggressive expansion plans in the Asia Pacific.627 words
-
Advertisement557 1996-06-15 60 Job requirements: Degree in Accountancy or its equivalent accounting qualifications 2-3 years commercial work experience and some audit experience would be advantageous Conversant with computer accounting Job responsibilities: Inventory control, warehouse, logistic, distribution, monitoring and reporting Credit control, collection and receivable accounting Computer system implementation and internal control procedures Implement557 words
-
Advertisement820 1996-06-15 60 I Around SsBo,ooo p.a. plus car and other generous benefits. I Our client, a local subsidiary of an established American based Corporation j I and a leading manufacturer of fine precision optics seeks to appoint a competent I 1 and experienced Westerner for the position of Managing Director. I Reporting820 words
-
Advertisement645 1996-06-15 60 REGIONAL CONTAINER LINES Group of Companies engaged in 1 shipagencies, shipmanagement, warehousing, feeder services invite I applications for the following positions: A stnlor position, those with strong knowledge and experience will be preferred. Degree/Diploma in Computer Science or related discipline Significant experience in Business Analysts/Planning and Data Modeing Knowledge of645 words
-
-
Page 61 Advertisements
-
Advertisement733 1996-06-15 61 fc^ R.S.H. SPORTS (S) pteud A m«mk«r of tk« Royal Sporting House Group Royal Sporting House is Singapore's premier sporting chain the innovator and the company to watch in the market. With a relentless flow of revolutionary retailing concepts that transformed the sporting goods scene in this part of the733 words
-
Advertisement685 1996-06-15 61 1 ZENITK~ ■■■■■■■■■■■■■KaSHJIaMUiHKMMASMUMMfII I Nothing happens by itself. To succeed you mm must be daring, far-sighted and know l|| This is the philosophy and spirit of innovation Vf I and enterprise which drives the master Swiss watchmakers of Zenith creator of the world's first automatic chronograph movement. If you believe685 words
-
Advertisement503 1996-06-15 61 JBr Eastern Wire AmemberofNatSteel Eastern Wire, an established manufacturer and supplier of engineered steel wire mesh for the construction industry, invites suitably qualified candidates to join us as: Duties and responsibilities: To provide technical advice to customers on RC design To provide engineering support to sales and technical department To503 words
-
Advertisement642 1996-06-15 61 We are a US Multinational Company marketing a wide I I range of consumer, pharmaceutical and nutritional I I products. In line with our expansion plans, we have a I I vacancy for: I Promotion manager 1 for our wide range off babycare products I I Job Scope: The successful642 words
-
-
Page 62 Advertisements
-
Advertisement1105 1996-06-15 62 W^iaKatL^Jlk. mmiJl^k m £\M m A L^J M LWj "y* ~M Tenders are invited for: CONSTRUCTION OF QINIRAI, PUHPINGS A DIMOUTION WORKS 1 ERECTION AND COMPLETION OF A SINGLE STOREY EATING HOUSE AND BIN CENTRE INCLUDING DEMOLITION OF EXISTING HAWKER CENTRE AND BIN CENTRE, AND ANCILLARY WORKS AT TOA PAYOH1,105 words
-
Advertisement636 1996-06-15 62 THE BANKRUPTCY ACT (ACT 15 OF ***** THE BANKRUPTCY RULES 1996 In Bankruptcy Re: TAN CHWEE KEE ANTHONY (NRIC NO. *****65/E) ...Judgment Debtor Ex Pane: AMERICAN EXPRESS BANK LTD(RCNo.Fq2IBOH) ...Judgment Creditors STATUTORY DEMAND UNDER SECTION 62 OF THE BANKRUPTCY ACT 1996 NQTJCE OF ADVERTISafI: NI To: TAN CHWEE KEE ANTHONY636 words
-
Advertisement550 1996-06-15 62 LUAN TIANG COMPANY LIMITED NOTICE NOTICE IS HEREBY GIVEN that the 50th Annual General Meeting of the Company will be held at No. 1 10 Middle Road #08-01/02 Chiat Hong Building, Singapore *****0 on Sunday, the 30 June 1996 at 2.00 pm. AGENDA 1. To receive the Directors' Report and550 words
-
Advertisement353 1996-06-15 62 ■Mj 1 1 1 1 m—i.ii— —»-^a»— i^»^^^»^—— a—aan^— a» THE BANKRUPTCY ACT IfJS (ACT IS OF IMS) NOTICE OF INTENDED DIVIDEND BKCY NO: 111/58 Chua Cheng Hin (*****43/F) of 725 Bedok Reservoir Road #04-5202 Singapore *****5 214/77 Tan Sian Peng (*****03) of 736 Jurong West Street 75 #12-09 Singapore353 words
-